Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CEACAM6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysate)

Rabbit CEACAM6 Polyclonal Antibody | anti-CEACAM6 antibody

CEACAM6 antibody - N-terminal region

Gene Names
CEACAM6; NCA; CEAL; CD66c
Reactivity
Guinea Pig, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CEACAM6; Polyclonal Antibody; CEACAM6 antibody - N-terminal region; anti-CEACAM6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVI
Sequence Length
344
Applicable Applications for anti-CEACAM6 antibody
Western Blot (WB)
Homology
Guinea Pig: 79%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CEACAM6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CEACAM6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysate)

Western Blot (WB) (WB Suggested Anti-CEACAM6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysate)
Related Product Information for anti-CEACAM6 antibody
This is a rabbit polyclonal antibody against CEACAM6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo. CEACAM6 expression is elevated in many solid tumors, but variable as a function
Product Categories/Family for anti-CEACAM6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
carcinoembryonic antigen-related cell adhesion molecule 6 preproprotein
NCBI Official Synonym Full Names
carcinoembryonic antigen related cell adhesion molecule 6
NCBI Official Symbol
CEACAM6
NCBI Official Synonym Symbols
NCA; CEAL; CD66c
NCBI Protein Information
carcinoembryonic antigen-related cell adhesion molecule 6
UniProt Protein Name
Carcinoembryonic antigen-related cell adhesion molecule 6
UniProt Gene Name
CEACAM6
UniProt Synonym Gene Names
NCA

NCBI Description

This gene encodes a protein that belongs to the carcinoembryonic antigen (CEA) family whose members are glycosyl phosphatidyl inositol (GPI) anchored cell surface glycoproteins. Members of this family play a role in cell adhesion and are widely used as tumor markers in serum immunoassay determinations of carcinoma. This gene affects the sensitivity of tumor cells to adenovirus infection. The protein encoded by this gene acts as a receptor for adherent-invasive E. coli adhesion to the surface of ileal epithelial cells in patients with Crohn's disease. This gene is clustered with genes and pseudogenes of the cell adhesion molecules subgroup of the CEA family on chromosome 19. [provided by RefSeq, Apr 2014]

Uniprot Description

CEACAM6: a glycosylphosphatidylinositol(GPI)-linked glycoprotein implicated in a variety of human cancers. Expressed on epithelial cells of various tissues, especially colon, lung, pancreas, trachea, and bone marrow. Participates in innate immune defense, cell proliferation and differentiation. Expressed at high levels in gastrointestinal tract, pancreatic and lung tumors. CEACAM6 promotes tumor angiogenesis in gastric cancer. May enhance invasiveness and metastatic potential in gastric and pancreatic cancer by promoting EMT via PI3K/AKT signaling. Upregulated by the pro-inflammatory cytokine IL-6. Belongs to the immunoglobulin superfamily/CEA family.

Protein type: Membrane protein, GPI anchor; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: extracellular space; integral to plasma membrane; plasma membrane

Molecular Function: protein binding

Biological Process: cell-cell signaling; leukocyte migration; positive regulation of cell migration; positive regulation of cell proliferation; signal transduction

Research Articles on CEACAM6

Similar Products

Product Notes

The CEACAM6 ceacam6 (Catalog #AAA3205888) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CEACAM6 antibody - N-terminal region reacts with Guinea Pig, Human and may cross-react with other species as described in the data sheet. AAA Biotech's CEACAM6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CEACAM6 ceacam6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KLTIESTPFN VAEGKEVLLL AHNLPQNRIG YSWYKGERVD GNSLIVGYVI. It is sometimes possible for the material contained within the vial of "CEACAM6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.