Western Blot (WB)
(WB Suggested Anti-FST Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Rabbit FST Polyclonal Antibody | anti-FST antibody
FST antibody - middle region
Gene Names
FST; FS
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FST; Polyclonal Antibody; FST antibody - middle region; anti-FST antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCN
Sequence Length
317
Applicable Applications for anti-FST antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Goat: 92%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FST
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-FST Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Western Blot (WB)
(WB Suggested Anti-FST Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Related Product Information for anti-FST antibody
This is a rabbit polyclonal antibody against FST. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.
Target Description: Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.
Product Categories/Family for anti-FST antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35kDa
NCBI Official Full Name
follistatin isoform FST317
NCBI Official Synonym Full Names
follistatin
NCBI Official Symbol
FST
NCBI Official Synonym Symbols
FS
NCBI Protein Information
follistatin
Protein Family
NCBI Description
Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin. [provided by RefSeq, Jul 2008]
Research Articles on FST
Similar Products
Product Notes
The FST (Catalog #AAA3206289) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FST antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FST can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FST for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALLKARCKEQ PELEVQYQGR CKKTCRDVFC PGSSTCVVDQ TNNAYCVTCN. It is sometimes possible for the material contained within the vial of "FST, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
