Immunofluorescence (IF)
(Sample Type : Spinal Cord, ventral horns)
Rabbit HTR3B Polyclonal Antibody | anti-HTR3B antibody
HTR3B antibody - N-terminal region
Gene Names
HTR3B; 5-HT3B
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
HTR3B; Polyclonal Antibody; HTR3B antibody - N-terminal region; anti-HTR3B antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT
Sequence Length
441
Applicable Applications for anti-HTR3B antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 79%; Dog: 77%; Guinea Pig: 79%; Human: 100%; Mouse: 77%; Pig: 86%; Rabbit: 86%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HTR3B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunofluorescence (IF)
(Sample Type : Spinal Cord, ventral horns)
Immunofluorescence (IF)
(Sample Type : Spinal Cord, ventral horns)
Immunohistochemistry (IHC)
(Rabbit Anti-HTR3B AntibodyParaffin Embedded Tissue: Human SpleenCellular Data: Spleen cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Immunohistochemistry (IHC)
(Rabbit Anti-HTR3B AntibodyParaffin Embedded Tissue: Human SpleenCellular Data: Spleen cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Western Blot (WB)
(WB Suggested Anti-HTR3B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-HTR3B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-HTR3B antibody
This is a rabbit polyclonal antibody against HTR3B. It was validated on Western Blot and immunohistochemistry
Target Description: The product of HTR3B belongs to the ligand-gated ion channel receptor superfamily. HTR3B encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation.
Target Description: The product of HTR3B belongs to the ligand-gated ion channel receptor superfamily. HTR3B encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation.
Product Categories/Family for anti-HTR3B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
5-hydroxytryptamine receptor 3B isoform 1
NCBI Official Synonym Full Names
5-hydroxytryptamine receptor 3B
NCBI Official Symbol
HTR3B
NCBI Official Synonym Symbols
5-HT3B
NCBI Protein Information
5-hydroxytryptamine receptor 3B
UniProt Protein Name
5-hydroxytryptamine receptor 3B
Protein Family
UniProt Gene Name
HTR3B
UniProt Synonym Gene Names
5-HT3-B; 5-HT3B
UniProt Entry Name
5HT3B_HUMAN
NCBI Description
The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It is not functional as a homomeric complex, but a pentaheteromeric complex with subunit A (HTR3A) displays the full functional features of this receptor. [provided by RefSeq, Aug 2011]
Research Articles on HTR3B
Similar Products
Product Notes
The HTR3B htr3b (Catalog #AAA3202468) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HTR3B antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HTR3B can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the HTR3B htr3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PLWACILVAA GILATDTHHP QDSALYHLSK QLLQKYHKEV RPVYNWTKAT. It is sometimes possible for the material contained within the vial of "HTR3B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
