Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Htr3a Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Rat Brain)

Rabbit Htr3a Polyclonal Antibody | anti-HTR3A antibody

Htr3a antibody - middle region

Gene Names
Htr3a; 5HT3; Htr3; 5-HT3; 5-HT3A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Htr3a; Polyclonal Antibody; Htr3a antibody - middle region; anti-HTR3A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PATAIGTPLIGVYFVVCMALLVISLAETIFIVQLVHKQDLQRPVPDWLRH
Sequence Length
483
Applicable Applications for anti-HTR3A antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Htr3a Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Rat Brain)

Western Blot (WB) (WB Suggested Anti-Htr3a Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Rat Brain)
Related Product Information for anti-HTR3A antibody
This is a rabbit polyclonal antibody against Htr3a. It was validated on Western Blot

Target Description: This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses in neurons. It is a cation-specific, but otherwise relatively nonselective, ion channel.
Product Categories/Family for anti-HTR3A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
5-hydroxytryptamine receptor 3A
NCBI Official Synonym Full Names
5-hydroxytryptamine receptor 3A
NCBI Official Symbol
Htr3a
NCBI Official Synonym Symbols
5HT3; Htr3; 5-HT3; 5-HT3A
NCBI Protein Information
5-hydroxytryptamine receptor 3A
UniProt Protein Name
5-hydroxytryptamine receptor 3A
UniProt Gene Name
Htr3a
UniProt Synonym Gene Names
5ht3; Htr3; 5-HT3-A; 5-HT3A; 5-HT-3; 5-HT3R

NCBI Description

receptor for 5-hydroxytryptamine (serotonin); functions as a ligand-gated ion channel [RGD, Feb 2006]

Uniprot Description

5-HT(3): This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses in neurons. It is a cation-specific, but otherwise relatively nonselective, ion channel. Belongs to the ligand-gated ion channel (TC 1.A.9) family. 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily. HTR3A sub-subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Channel, cation; Channel, ligand-gated; Membrane protein, integral; Membrane protein, multi-pass; Transporter, ion channel

Chromosomal Location of Human Ortholog: 8q23

Cellular Component: axon; cell junction; cell soma; cleavage furrow; cytoplasm; integral component of plasma membrane; plasma membrane; postsynaptic membrane; serotonin-activated cation-selective channel complex

Molecular Function: serotonin binding; serotonin-gated cation-selective channel activity

Biological Process: cation transmembrane transport; cellular response to growth factor stimulus; positive regulation of ion transmembrane transporter activity; response to cocaine; response to ethanol; signal transduction; synaptic transmission

Research Articles on HTR3A

Similar Products

Product Notes

The HTR3A htr3a (Catalog #AAA3202665) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Htr3a antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Htr3a can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HTR3A htr3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PATAIGTPLI GVYFVVCMAL LVISLAETIF IVQLVHKQDL QRPVPDWLRH. It is sometimes possible for the material contained within the vial of "Htr3a, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.