Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HSPH1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human HSPH1 Polyclonal Antibody | anti-HSPH1 antibody

HSPH1 Antibody - middle region

Gene Names
HSPH1; HSP105; HSP105A; HSP105B; NY-CO-25
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
HSPH1; Polyclonal Antibody; HSPH1 Antibody - middle region; anti-HSPH1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ADKANEKKVDQPPEAKKPKIKVVNVELPIEANLVWQLGKDLLNMYIETEG
Sequence Length
858
Applicable Applications for anti-HSPH1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HSPH1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HSPH1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HSPH1Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-HSPH1 antibody
Acts as a nucleotide-exchange factor (NEF) for chaperone proteins HSPA1A and HSPA1B, promoting the release of ADP from HSPA1A/B thereby triggering client/substrate protein release. Prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. Inhibits HSPA8/HSC70 ATPase and chaperone activities.
Product Categories/Family for anti-HSPH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97 kDa
NCBI Official Full Name
heat shock protein 105 kDa isoform 2
NCBI Official Synonym Full Names
heat shock protein family H (Hsp110) member 1
NCBI Official Symbol
HSPH1
NCBI Official Synonym Symbols
HSP105; HSP105A; HSP105B; NY-CO-25
NCBI Protein Information
heat shock protein 105 kDa
UniProt Protein Name
Heat shock protein 105 kDa
Protein Family
UniProt Gene Name
HSPH1
UniProt Synonym Gene Names
HSP105; HSP110; KIAA0201
UniProt Entry Name
HS105_HUMAN

NCBI Description

This gene encodes a member of the heat shock protein 70 family of proteins. The encoded protein functions as a nucleotide exchange factor for the molecular chaperone heat shock cognate 71 kDa protein (Hsc70). In addition, this protein plays a distinct but related role as a holdase that inhibits the aggregation of misfolded proteins, including the cystic fibrosis transmembrane conductance regulator (CFTR) protein. Elevated expression of this protein has been observed in numerous human cancers. [provided by RefSeq, Mar 2017]

Uniprot Description

HSP105: a molecular chaperone of the heat shock protein 70 family. Has ATPase activity. Expressed at especially high levels in mammalian brain and has been shown to suppress apoptosis in neuronal cells and to prevent the aggregation of proteins following heat shock. Known to interact with a variety of proteins including alpha-tubulin and the androgen receptor. Two alternatively spliced isoforms have been described.

Protein type: Chaperone; Heat shock protein

Chromosomal Location of Human Ortholog: 13q12.3

Cellular Component: nucleoplasm; microtubule; cytoplasm; extracellular region; cytosol

Molecular Function: protein binding; ATP binding; alpha-tubulin binding

Biological Process: receptor-mediated endocytosis; positive regulation of NK T cell activation; chaperone cofactor-dependent protein folding; positive regulation of MHC class I biosynthetic process; response to unfolded protein

Research Articles on HSPH1

Similar Products

Product Notes

The HSPH1 hsph1 (Catalog #AAA3222520) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSPH1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSPH1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HSPH1 hsph1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ADKANEKKVD QPPEAKKPKI KVVNVELPIE ANLVWQLGKD LLNMYIETEG. It is sometimes possible for the material contained within the vial of "HSPH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.