Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Sample Type: MCF-7Sample Type :MCF7 cellsPrimary Antibody Dilution :1:200Secondary Antibody:Anti-rabbit-FITCSecondary Antibody Dilution:1:500Color/Signal Descriptions:DAPI: Blue hnRNPL: GreenGene Name:HNRPLSubmitted by:Anonymous)

Rabbit HNRPL Polyclonal Antibody | anti-HNRNPL antibody

HNRPL antibody - N-terminal region

Gene Names
HNRNPL; HNRPL; hnRNP-L; P/OKcl.14
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunofluorescence, Immunoprecipitation, Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
HNRPL; Polyclonal Antibody; HNRPL antibody - N-terminal region; anti-HNRNPL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV
Sequence Length
589
Applicable Applications for anti-HNRNPL antibody
Immunofluorescence (IF), Immunoprecipitation (IP), Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunofluorescence (IF)

(Sample Type: MCF-7Sample Type :MCF7 cellsPrimary Antibody Dilution :1:200Secondary Antibody:Anti-rabbit-FITCSecondary Antibody Dilution:1:500Color/Signal Descriptions:DAPI: Blue hnRNPL: GreenGene Name:HNRPLSubmitted by:Anonymous)

Immunofluorescence (IF) (Sample Type: MCF-7Sample Type :MCF7 cellsPrimary Antibody Dilution :1:200Secondary Antibody:Anti-rabbit-FITCSecondary Antibody Dilution:1:500Color/Signal Descriptions:DAPI: Blue hnRNPL: GreenGene Name:HNRPLSubmitted by:Anonymous)

Immunohistochemistry (IHC)

(Rabbit Anti-HNRPL antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-HNRPL antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC)

(Rabbit Anti-HNRPL AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HepatocytesAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-HNRPL AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HepatocytesAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunoprecipitation (IP)

(Sample Type: K562Amount and Sample Type :Lane 1: 5% InputLane 2: 5% SupLane 3: Normal IgGLane 4: hn-RNPL ppt. k562 sampleIP Antibody :HNRPLAmount of IP Antibody :Primary Antibody :HNRPLPrimary Antibody Dilution:1:4000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name :HNRPLSubmitted by:Anonymous)

Immunoprecipitation (IP) (Sample Type: K562Amount and Sample Type :Lane 1: 5% InputLane 2: 5% SupLane 3: Normal IgGLane 4: hn-RNPL ppt. k562 sampleIP Antibody :HNRPLAmount of IP Antibody :Primary Antibody :HNRPLPrimary Antibody Dilution:1:4000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name :HNRPLSubmitted by:Anonymous)

Western Blot (WB)

(Sample Type: HeLa S3, MCF7, K562Lanes :Lane 1: 20ug HeLa S3 lysate Lane 2: 20ug MCF7 lysate Lane 3: 20ug K562 lysatePrimary Antibody Dilution :1:4000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:5000Gene Name :HNRPLSubmitted by :Anonymous)

Western Blot (WB) (Sample Type: HeLa S3, MCF7, K562Lanes :Lane 1: 20ug HeLa S3 lysate Lane 2: 20ug MCF7 lysate Lane 3: 20ug K562 lysatePrimary Antibody Dilution :1:4000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:5000Gene Name :HNRPLSubmitted by :Anonymous)

Western Blot (WB)

(Host: MouseTarget Name: HNRNPLSample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: HNRNPLSample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: HNRNPLSample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HNRNPLSample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-HNRPL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateHNRNPL is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-HNRPL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateHNRNPL is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-HNRNPL antibody
This is a rabbit polyclonal antibody against HNRPL. It was validated on Western Blot and immunohistochemistry

Target Description: Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA. Heterogeneous nuclear ribonucleoprotein L is present in the nucleoplasm as part of the HNRP complex. HNRP proteins have also been identified outside of the nucleoplasm. Exchange of hnRNP for mRNA-binding proteins accompanies transport of mRNA from the nucleus to the cytoplasm. Since HNRP proteins have been shown to shuttle between the nucleus and the cytoplasm, it is possible that they also have cytoplasmic functions.Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA. Heterogeneous nuclear ribonucleoprotein L is present in the nucleoplasm as part of the HNRP complex. HNRP proteins have also been identified outside of the nucleoplasm. Exchange of hnRNP for mRNA-binding proteins accompanies transport of mRNA from the nucleus to the cytoplasm. Since HNRP proteins have been shown to shuttle between the nucleus and the cytoplasm, it is possible that they also have cytoplasmic functions. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein L isoform a
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein L
NCBI Official Symbol
HNRNPL
NCBI Official Synonym Symbols
HNRPL; hnRNP-L; P/OKcl.14
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein L
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein L
UniProt Gene Name
HNRNPL
UniProt Synonym Gene Names
HNRPL; hnRNP L
UniProt Entry Name
HNRPL_HUMAN

NCBI Description

Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA. Heterogeneous nuclear ribonucleoprotein L is present in the nucleoplasm as part of the HNRP complex. HNRP proteins have also been identified outside of the nucleoplasm. Exchange of hnRNP for mRNA-binding proteins accompanies transport of mRNA from the nucleus to the cytoplasm. Since HNRP proteins have been shown to shuttle between the nucleus and the cytoplasm, it is possible that they also have cytoplasmic functions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

hnRNP L: This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Is associated with most nascent transcripts including those of the landmark giant loops of amphibian lampbrush chromosomes. Associates, together with APEX1, to the negative calcium responsive element (nCaRE) B2 of the APEX2 promoter. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA splicing; RNA-binding

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: nucleoplasm; membrane; cytoplasm; ribonucleoprotein complex; nucleus

Molecular Function: protein binding; RNA binding; nucleotide binding

Biological Process: nuclear mRNA splicing, via spliceosome; RNA processing; RNA splicing; gene expression

Research Articles on HNRNPL

Similar Products

Product Notes

The HNRNPL hnrnpl (Catalog #AAA3205177) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNRPL antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HNRPL can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunoprecipitation (IP), Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the HNRNPL hnrnpl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAGGGGGGEN YDDPHKTPAS PVVHIRGLID GVVEADLVEA LQEFGPISYV. It is sometimes possible for the material contained within the vial of "HNRPL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.