Western Blot (WB)
(Host: RabbitTarget Name: HMGB3Sample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse HMGB3 Polyclonal Antibody | anti-HMGB3 antibody
HMGB3 Antibody-middle region
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HMGB3; Polyclonal Antibody; HMGB3 Antibody-middle region; high mobility group protein B3; Hmg4; Hmg2a; anti-HMGB3 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
VRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGI
Applicable Applications for anti-HMGB3 antibody
Western Blot (WB)
Protein Size
200 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse HMGB3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: HMGB3Sample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: HMGB3Sample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-HMGB3 antibody
Description of Target: Multifunctional protein with various roles in different cellular compartments. May act in a redox sensitive manner. Associates with chromatin and binds DNA with a preference to non-canonical DNA structures such as single-stranded DNA. Can bent DNA and enhance DNA flexibility by looping thus providing a mechanism to promote activities on various gene promoters (By similarity). Proposed to be involved in the innate immune response to nucleic acids by acting as a cytoplasmic promiscuous immunogenic DNA/RNA sensor. Negatively regulates B-cell and myeloid cell differentiation. In hematopoietic stem cells may regulate the balance between self-renewal and differentiation. Involved in negative regulation of canonical Wnt signaling.
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
23kDa
UniProt Protein Name
High mobility group protein B3
Protein Family
UniProt Gene Name
Hmgb3
UniProt Synonym Gene Names
Hmg2a; Hmg4; HMG-2a; HMG-4
UniProt Entry Name
HMGB3_MOUSE
Uniprot Description
HMGB3: Binds preferentially single-stranded DNA and unwinds double stranded DNA. Belongs to the HMGB family.
Protein type: DNA-binding
Cellular Component: chromosome; cytoplasm; nucleus
Molecular Function: DNA binding; RNA binding
Biological Process: immune system process; innate immune response; negative regulation of B cell differentiation; negative regulation of cell differentiation; negative regulation of myeloid cell differentiation; regulation of transcription, DNA-dependent; transcription, DNA-dependent
Similar Products
Product Notes
The HMGB3 hmgb3 (Catalog #AAA3249832) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HMGB3 Antibody-middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HMGB3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HMGB3 hmgb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VRYDREMKDY GPAKGGKKKK DPNAPKRPPS GFFLFCSEFR PKIKSTNPGI. It is sometimes possible for the material contained within the vial of "HMGB3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
