Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HMGA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysateHMGA1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells)

Rabbit HMGA1 Polyclonal Antibody | anti-HMGA1 antibody

HMGA1 antibody - N-terminal region

Gene Names
HMGA1; HMG-R; HMGIY; HMGA1A
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HMGA1; Polyclonal Antibody; HMGA1 antibody - N-terminal region; anti-HMGA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRP
Sequence Length
96
Applicable Applications for anti-HMGA1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HMGA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HMGA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysateHMGA1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells)

Western Blot (WB) (WB Suggested Anti-HMGA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysateHMGA1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells)
Related Product Information for anti-HMGA1 antibody
This is a rabbit polyclonal antibody against HMGA1. It was validated on Western Blot

Target Description: This gene encodes a non-histone protein involved in many cellular processes, including regulation of inducible gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of A+T-rich regions in double-stranded DNA. It has little secondary structure in solution but assumes distinct conformations when bound to substrates such as DNA or other proteins. The encoded protein is frequently acetylated and is found in the nucleus. At least seven transcript variants encoding two different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
high mobility group protein HMG-I/HMG-Y isoform b
NCBI Official Synonym Full Names
high mobility group AT-hook 1
NCBI Official Symbol
HMGA1
NCBI Official Synonym Symbols
HMG-R; HMGIY; HMGA1A
NCBI Protein Information
high mobility group protein HMG-I/HMG-Y
UniProt Protein Name
High mobility group AT-hook 1
UniProt Gene Name
HMGA1
UniProt Entry Name
Q5T6U8_HUMAN

NCBI Description

This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes. [provided by RefSeq, Jan 2016]

Uniprot Description

HMGA1: HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions. A chromosomal aberration involving HMGA1 is found in pulmonary chondroid hamartoma. Translocation t(6;14)(p21;q23-24) with RAD51B. Belongs to the HMGA family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 6p21

Cellular Component: nucleoplasm; transcription factor complex; focal adhesion; nucleus; cytosol

Molecular Function: retinoid X receptor binding; peroxisome proliferator activated receptor binding; protein binding; DNA-(apurinic or apyrimidinic site) lyase activity; enzyme binding; DNA binding; ligand-dependent nuclear receptor transcription coactivator activity; AT DNA binding; retinoic acid receptor binding; 5'-deoxyribose-5-phosphate lyase activity; transcription factor binding

Biological Process: DNA unwinding during replication; negative regulation of cell proliferation; negative regulation of chromatin silencing; regulation of transcription, DNA-dependent; nucleosome disassembly; viral reproduction; transcription, DNA-dependent; base-excision repair; positive regulation of transcription, DNA-dependent; response to virus; protein complex assembly; negative regulation of transcription, DNA-dependent; DNA catabolic process, endonucleolytic

Research Articles on HMGA1

Similar Products

Product Notes

The HMGA1 hmga1 (Catalog #AAA3203904) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HMGA1 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HMGA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HMGA1 hmga1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSESSSKSSQ PLASKQEKDG TEKRGRGRPR KQPPKEPSEV PTPKRPRGRP. It is sometimes possible for the material contained within the vial of "HMGA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.