Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Mouse TNFSF11/RANK L/TRANCE Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

TNFSF11/RANK L/TRANCE Recombinant Protein | TNFSF11 recombinant protein

Recombinant Mouse TNFSF11/RANK L/TRANCE Protein

Gene Names
Tnfsf11; ODF; OPGL; RANKL; Ly109l; Trance
Purity
>95% by SDS-PAGE.
Synonyms
TNFSF11/RANK L/TRANCE; Recombinant Mouse TNFSF11/RANK L/TRANCE Protein; Tumor necrosis factor ligand superfamily member 11; Tnfsf11; Osteoclast differentiationfactor; ODF; Osteoprotegerin ligand; OPGL; Receptor activator of nuclear factor kappa-Bligand; RANKL; TNF-related activation-induced cytokine; TRANCE; CD254; TNFSF11 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Sequence
QRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Sequence Length
316
Species
Mouse
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
No tag
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Mouse TNFSF11/RANK L/TRANCE Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Mouse TNFSF11/RANK L/TRANCE Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for TNFSF11 recombinant protein
Description: Recombinant Mouse TNFSF11/RANK L/TRANCE Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gln137-Asp316) of mouse TNFSF11/RANK L/TRANCE (Accession #O35235).

Background: Mouse tumor necrosis factor ligand superfamily member 11(Tnfsf11) is a member of the tumor necrosis factor(TNF) cytokine family. Tnfsf11 is widely expressed in cells including T cells and T cell rich organs, such asthymus and lymph nodes. This cytokine can bind to TNFRSF11B/OPG andTNFRSF11A/RANK. Tnfsf11 is involvedin a number of fundamental biological processes such as acting as regulator of interactions between T-cells anddendritic cells, the regulation of the T-cell-dependent immune response and enhancing bone-resorption inhumoral hypercalcemia of malignancy. It augments the ability of dendritic cells to stimulate naive T-cellproliferation.
Product Categories/Family for TNFSF11 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 11
NCBI Official Synonym Full Names
tumor necrosis factor (ligand) superfamily, member 11
NCBI Official Symbol
Tnfsf11
NCBI Official Synonym Symbols
ODF; OPGL; RANKL; Ly109l; Trance
NCBI Protein Information
tumor necrosis factor ligand superfamily member 11
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 11
UniProt Gene Name
Tnfsf11
UniProt Synonym Gene Names
Opgl; Rankl; Trance; ODF; OPGL; RANKL; TRANCE
UniProt Entry Name
TNF11_MOUSE

Uniprot Description

TNFSF11: Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy. Homotrimer. Up-regulated by T-cell receptor stimulation. Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid. Belongs to the tumor necrosis factor family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Cellular Component: extracellular space; membrane; cytoplasm; extracellular region; integral to membrane; plasma membrane; intracellular

Molecular Function: protein binding; cytokine activity; tumor necrosis factor receptor superfamily binding; tumor necrosis factor receptor binding

Biological Process: ossification; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of osteoclast differentiation; multicellular organismal development; cytokine and chemokine mediated signaling pathway; positive regulation of JNK cascade; mammary gland epithelial cell proliferation; osteoclast differentiation; lymph node development; activation of JNK activity; positive regulation of corticotropin-releasing hormone secretion; activation of NF-kappaB transcription factor; positive regulation of homotypic cell-cell adhesion; calcium ion homeostasis; positive regulation of protein kinase B signaling cascade; monocyte chemotaxis; positive regulation of MAP kinase activity; organ morphogenesis; regulation of osteoclast differentiation; tumor necrosis factor-mediated signaling pathway; positive regulation of bone resorption; positive regulation of transcription from RNA polymerase II promoter; immune response; positive regulation of transcription factor activity; positive regulation of T cell activation; cell differentiation; positive regulation of phosphorylation; protein homooligomerization; bone resorption

Research Articles on TNFSF11

Similar Products

Product Notes

The TNFSF11 tnfsf11 (Catalog #AAA9140176) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QRFSGAPAMM EGSWLDVAQR GKPEAQPFAH LTINAASIPS GSHKVTLSSW YHDRGWAKIS NMTLSNGKLR VNQDGFYYLY ANICFRHHET SGSVPTDYLQ LMVYVVKTSI KIPSSHNLMK GGSTKNWSGN SEFHFYSINV GGFFKLRAGE EISIQVSNPS LLDPDQDATY FGAFKVQDID. It is sometimes possible for the material contained within the vial of "TNFSF11/RANK L/TRANCE, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.