Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HIVEP1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit HIVEP1 Polyclonal Antibody | anti-HIVEP1 antibody

HIVEP1 Antibody - middle region

Gene Names
HIVEP1; GAAP; ZAS1; CIRIP; MBP-1; ZNF40; CRYBP1; ZNF40A; PRDII-BF1; Schnurri-1
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HIVEP1; Polyclonal Antibody; HIVEP1 Antibody - middle region; anti-HIVEP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FSYERSGYDLEESDGPDEDDNENEDDDEDSQAESVLSATPSVTASPQHLP
Sequence Length
701
Applicable Applications for anti-HIVEP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 86%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human HIVEP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HIVEP1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HIVEP1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-HIVEP1 antibody
This is a rabbit polyclonal antibody against HIVEP1. It was validated on Western Blot

Target Description: This gene encodes a transcription factor belonging to the ZAS family, members of which are large proteins that contain a ZAS domain - a modular protein structure consisting of a pair of C2H2 zinc fingers with an acidic-rich region and a serine/threonine-rich sequence. These proteins bind specifically to the DNA sequence motif, GGGACTTTCC, found in the enhancer elements of several viral promoters, including human immunodeficiency virus (HIV), and to related sequences found in the enhancer elements of a number of cellular promoters. This protein binds to this sequence motif, suggesting a role in the transcriptional regulation of both viral and cellular genes.
Product Categories/Family for anti-HIVEP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
zinc finger protein 40
NCBI Official Synonym Full Names
human immunodeficiency virus type I enhancer binding protein 1
NCBI Official Symbol
HIVEP1
NCBI Official Synonym Symbols
GAAP; ZAS1; CIRIP; MBP-1; ZNF40; CRYBP1; ZNF40A; PRDII-BF1; Schnurri-1
NCBI Protein Information
zinc finger protein 40
UniProt Protein Name
Zinc finger protein 40
Protein Family
UniProt Gene Name
HIVEP1
UniProt Synonym Gene Names
ZNF40; CIRIP; GAAP; HIV-EP1; MBP-1; PRDII-BF1
UniProt Entry Name
ZEP1_HUMAN

NCBI Description

This gene encodes a transcription factor belonging to the ZAS family, members of which are large proteins that contain a ZAS domain - a modular protein structure consisting of a pair of C2H2 zinc fingers with an acidic-rich region and a serine/threonine-rich sequence. These proteins bind specifically to the DNA sequence motif, GGGACTTTCC, found in the enhancer elements of several viral promoters, including human immunodeficiency virus (HIV), and to related sequences found in the enhancer elements of a number of cellular promoters. This protein binds to this sequence motif, suggesting a role in the transcriptional regulation of both viral and cellular genes. [provided by RefSeq, Oct 2011]

Research Articles on HIVEP1

Similar Products

Product Notes

The HIVEP1 hivep1 (Catalog #AAA3219261) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HIVEP1 Antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HIVEP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HIVEP1 hivep1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSYERSGYDL EESDGPDEDD NENEDDDEDS QAESVLSATP SVTASPQHLP. It is sometimes possible for the material contained within the vial of "HIVEP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.