Rabbit Mxi1 Polyclonal Antibody | anti-MXI1 antibody
Mxi1 Antibody - N-terminal region
Gene Names
Mxi1; Mad2; Gm10197; bHLHc11
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Mxi1; Polyclonal Antibody; Mxi1 Antibody - N-terminal region; anti-MXI1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KEARCEGAGLVPVAPPAMPPAAAAPQPPAQPEEPAGAKPRCPFSDIFNTS
Sequence Length
295
Applicable Applications for anti-MXI1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 86%; Mouse: 100%; Pig: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Mxi1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-Mxi1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Brain, CortexPrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Immunohistochemistry (IHC)
(Rabbit Anti-Mxi1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human HeartPrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Western Blot (WB)
(Host: RabbitTarget Name: Mxi1Sample Type: Mouse Muscle lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MXI1 antibody
This is a rabbit polyclonal antibody against Mxi1. It was validated on Western Blot
Target Description: This gene encodes a protein containing a helix-loop-helix domain characteristic of transcription factors, which allows heterodimerization and sequence-specific DNA binding. The encoded protein is related to a family of Myc/Max/Mad proteins that are involved in the regulation of several cellular processes. The protein encoded by this gene is a transcriptional repressor thought to negatively regulate Myc function. Three alternatively spliced transcripts encoding different isoforms have been described.
Target Description: This gene encodes a protein containing a helix-loop-helix domain characteristic of transcription factors, which allows heterodimerization and sequence-specific DNA binding. The encoded protein is related to a family of Myc/Max/Mad proteins that are involved in the regulation of several cellular processes. The protein encoded by this gene is a transcriptional repressor thought to negatively regulate Myc function. Three alternatively spliced transcripts encoding different isoforms have been described.
Product Categories/Family for anti-MXI1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33kDa
NCBI Official Full Name
max-interacting protein 1 isoform b
NCBI Official Synonym Full Names
MAX interactor 1, dimerization protein
NCBI Official Symbol
Mxi1
NCBI Official Synonym Symbols
Mad2; Gm10197; bHLHc11
NCBI Protein Information
max-interacting protein 1
Protein Family
NCBI Description
This gene encodes a protein containing a helix-loop-helix domain characteristic of transcription factors, which allows heterodimerization and sequence-specific DNA binding. The encoded protein is related to a family of Myc/Max/Mad proteins that are involved in the regulation of several cellular processes. The protein encoded by this gene is a transcriptional repressor thought to negatively regulate Myc function. Three alternatively spliced transcripts encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
