Western Blot (WB)
(Host: RabbitTarget Name: ANXA8L2Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Rabbit ANXA8L2 Polyclonal Antibody | anti-ANXA8L2 antibody
ANXA8L2 antibody - middle region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ANXA8L2; Polyclonal Antibody; ANXA8L2 antibody - middle region; anti-ANXA8L2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYA
Sequence Length
327
Applicable Applications for anti-ANXA8L2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ANXA8L2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: ANXA8L2Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: ANXA8L2Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-ANXA8L2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-ANXA8L2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
Related Product Information for anti-ANXA8L2 antibody
This is a rabbit polyclonal antibody against ANXA8L2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ANXA8L2 is a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.
Target Description: ANXA8L2 is a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.
Product Categories/Family for anti-ANXA8L2 antibody
NCBI and Uniprot Product Information
Uniprot Description
ANXA8: This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade. Belongs to the annexin family.
Chromosomal Location of Human Ortholog: 10q11.22
Cellular Component: late endosome membrane; plasma membrane; cytosol
Molecular Function: actin filament binding; phosphatidylinositol-4,5-bisphosphate binding; phosphatidylinositol-3,4,5-triphosphate binding; calcium-dependent phospholipid binding; calcium ion binding; phosphatidylinositol-3,4-bisphosphate binding
Biological Process: endosome organization and biogenesis; blood coagulation; endosome transport
Similar Products
Product Notes
The ANXA8L2 anxa8 (Catalog #AAA3203195) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANXA8L2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ANXA8L2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ANXA8L2 anxa8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VFEEYEKIAN KSIEDSIKSE THGSLEEAML TVVKCTQNLH SYFAERLYYA. It is sometimes possible for the material contained within the vial of "ANXA8L2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
