Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HACE1Sample Type: OVCAR-3 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit HACE1 Polyclonal Antibody | anti-HACE1 antibody

HACE1 Antibody - N-terminal region

Gene Names
HACE1; SPPRS
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HACE1; Polyclonal Antibody; HACE1 Antibody - N-terminal region; anti-HACE1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYAFGRVKR
Sequence Length
694
Applicable Applications for anti-HACE1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HACE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HACE1Sample Type: OVCAR-3 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HACE1Sample Type: OVCAR-3 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-HACE1 antibody
This is a rabbit polyclonal antibody against HACE1. It was validated on Western Blot

Target Description: HACE1 is a E3 ubiquitin-protein ligase involved in Golgi membrane fusion and regulation of small GTPases. It acts as a regulator of Golgi membrane dynamics during the cell cycle: recruited to Golgi membrane by Rab proteins and regulates postmitotic Golgi membrane fusion. It acts by mediating ubiquitination during mitotic Golgi disassembly, ubiquitination serving as a signal for Golgi reassembly later, after cell division. HACE1 specifically interacts with GTP-bound RAC1, mediating ubiquitination and subsequent degradation of active RAC1, thereby playing a role in host defense against pathogens. It may also act as a transcription regulator via its interaction with RARB.
Product Categories/Family for anti-HACE1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase HACE1 isoform a
NCBI Official Synonym Full Names
HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1
NCBI Official Symbol
HACE1
NCBI Official Synonym Symbols
SPPRS
NCBI Protein Information
E3 ubiquitin-protein ligase HACE1
UniProt Protein Name
E3 ubiquitin-protein ligase HACE1
UniProt Gene Name
HACE1
UniProt Synonym Gene Names
KIAA1320
UniProt Entry Name
HACE1_HUMAN

NCBI Description

This gene encodes a HECT domain and ankyrin repeat-containing ubiquitin ligase. The encoded protein is involved in specific tagging of target proteins, leading to their subcellular localization or proteasomal degradation. The protein is a potential tumor suppressor and is involved in the pathophysiology of several tumors, including Wilm's tumor. [provided by RefSeq, Mar 2016]

Uniprot Description

HACE1: E3 ubiquitin-protein ligase involved in Golgi membrane fusion and regulation of small GTPases. Acts as a regulator of Golgi membrane dynamics during the cell cycle: recruited to Golgi membrane by Rab proteins and regulates postmitotic Golgi membrane fusion. Acts by mediating ubiquitination during mitotic Golgi disassembly, ubiquitination serving as a signal for Golgi reassembly later, after cell division. Specifically interacts with GTP-bound RAC1, mediating ubiquitination and subsequent degradation of active RAC1, thereby playing a role in host defense against pathogens. May also act as a transcription regulator via its interaction with RARB. Defects in HACE1 are a cause of Wilms tumor (WT). WT is a pediatric malignancy of kidney and one of the most common solid cancers in childhood. HACE1 is epigenetically down-regulated in sporadic Wilms tumor. Moreover, a t(5;6)(q21;q21) translocation that truncates HACE1 has been found in a child with bilateral, young-onset Wilms tumor. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.19; Ligase; EC 6.3.2.-; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 6q16.3

Cellular Component: Golgi membrane; endoplasmic reticulum; nucleus

Molecular Function: protein binding; Rac GTPase binding; ubiquitin-protein ligase activity; Rab GTPase binding; ligase activity

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; protein ubiquitination during ubiquitin-dependent protein catabolic process; Rac protein signal transduction; protein ubiquitination; cell cycle; Golgi organization and biogenesis; regulation of cell migration

Research Articles on HACE1

Similar Products

Product Notes

The HACE1 hace1 (Catalog #AAA3206797) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HACE1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HACE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HACE1 hace1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RARTVELPED NETAVYTLMP MVMADQHRSV SELLSNSKFD VNYAFGRVKR. It is sometimes possible for the material contained within the vial of "HACE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.