Rabbit MBD1 Polyclonal Antibody | anti-MBD1 antibody

MBD1 antibody - C-terminal region

Cat. Num. AAA3201105

• Gene Names: MBD1; RFT; PCM1; CXXC3
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purified
• Synonyms: MBD1; Polyclonal Antibody; MBD1 antibody - C-terminal region; anti-MBD1 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: EEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRS
• Sequence Length: 629

• Applicable Applications for anti-MBD1 antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 100%
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-MBD1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC)

(Rabbit Anti-MBD1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human TestisPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Western Blot (WB)

(WB Suggested Anti-MBD1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellMBD1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Related Product Information for anti-MBD1 antibody

This is a rabbit polyclonal antibody against MBD1. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of a family of nuclear proteins related by the presence of a methyl-CpG binding domain (MBD). These proteins are capable of binding specifically to methylated DNA, and some members can also repress transcription from methylated gene promoters. This protein contains multiple domains: MBD at the N-terminus that functions both in binding to methylated DNA and in protein interactions; several CXXC-type zinc finger domains that mediate binding to non-methylated CpG dinucleotides; transcriptional repression domain (TRD) at the C-terminus that is involved in transcription repression and in protein interactions. Numerous alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Product Categories/Family for anti-MBD1 antibody

Polyclonal; Transcription Factor; Cancer; Transcription Regulation; Cell Biology; Developmental Biology; Signal Transduction; Various; E3 & Ubiquitin; DNA/RNA/Protein Interactions; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 323462151
• NCBI GeneID: 4152
• NCBI Accession #: NP_001191067
• NCBI GenBank Nucleotide #: NM_001204138
• UniProt Accession #: Q9UIS9
• Molecular Weight: 69kDa
• NCBI Official Full Name: methyl-CpG-binding domain protein 1 isoform 8
• NCBI Official Synonym Full Names: methyl-CpG binding domain protein 1
• NCBI Official Symbol: MBD1
• NCBI Official Synonym Symbols: RFT; PCM1; CXXC3
• NCBI Protein Information: methyl-CpG-binding domain protein 1
• UniProt Protein Name: Methyl-CpG-binding domain protein 1
• Protein Family: Methyl-CpG-binding domain protein
• UniProt Gene Name: MBD1
• UniProt Synonym Gene Names: CXXC3; PCM1
• UniProt Entry Name: MBD1_HUMAN

NCBI Description

The protein encoded by this gene is a member of a family of nuclear proteins related by the presence of a methyl-CpG binding domain (MBD). These proteins are capable of binding specifically to methylated DNA, and some members can also repress transcription from methylated gene promoters. This protein contains multiple domains: MBD at the N-terminus that functions both in binding to methylated DNA and in protein interactions; several CXXC-type zinc finger domains that mediate binding to non-methylated CpG dinucleotides; transcriptional repression domain (TRD) at the C-terminus that is involved in transcription repression and in protein interactions. Numerous alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Feb 2011]