Rabbit DTX4 Polyclonal Antibody | anti-DTX4 antibody
DTX4 Antibody - C-terminal region
Gene Names
DTX4; RNF155
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DTX4; Polyclonal Antibody; DTX4 Antibody - C-terminal region; anti-DTX4 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTAQEKD
Sequence Length
619
Applicable Applications for anti-DTX4 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DTX4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: DTX4Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: DTX4Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: DTX4Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DTX4 antibody
This is a rabbit polyclonal antibody against DTX4. It was validated on Western Blot
Target Description: DTX4 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. It functions as an ubiquitin ligase protein in vivo, mediating 'Lys48'-linked polyubiquitination and promoting degradation of TBK1, targeting to TBK1 requires interaction with NLRP4.
Target Description: DTX4 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. It functions as an ubiquitin ligase protein in vivo, mediating 'Lys48'-linked polyubiquitination and promoting degradation of TBK1, targeting to TBK1 requires interaction with NLRP4.
Product Categories/Family for anti-DTX4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase DTX4 isoform 1
NCBI Official Synonym Full Names
deltex E3 ubiquitin ligase 4
NCBI Official Symbol
DTX4
NCBI Official Synonym Symbols
RNF155
NCBI Protein Information
E3 ubiquitin-protein ligase DTX4
UniProt Protein Name
E3 ubiquitin-protein ligase DTX4
Protein Family
UniProt Gene Name
DTX4
UniProt Synonym Gene Names
KIAA0937; RNF155; Deltex4
UniProt Entry Name
DTX4_HUMAN
Uniprot Description
DTX4: Regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Functions as an ubiquitin ligase protein in vivo, mediating 'Lys48'-linked polyubiquitination and promoting degradation of TBK1, targeting to TBK1 requires interaction with NLRP4. Belongs to the Deltex family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: EC 6.3.2.-; Ubiquitin conjugating system
Chromosomal Location of Human Ortholog: 11q12.1
Cellular Component: cytosol
Molecular Function: zinc ion binding; ligase activity
Biological Process: regulation of interferon type I production; Notch signaling pathway; positive regulation of interferon type I production; protein ubiquitination; innate immune response
