Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using GUCA1B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 3min.)
Rabbit anti-Mouse, Rat GUCA1B Polyclonal Antibody | anti-GUCA1B antibody
GUCA1B Polyclonal Antibody
Gene Names
GUCA1B; RP48; GCAP2; GUCA2
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
GUCA1B; Polyclonal Antibody; GUCA1B Polyclonal Antibody; GCAP2; GUCA2; RP48; anti-GUCA1B antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MGQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDGNGCIDRLELLNIVEGIYQLKKACRRELQTEQGQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDMNPSSWLAQQRRKSAMF
Sequence Length
200
Applicable Applications for anti-GUCA1B antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human GUCA1B
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane
Positive Samples
Mouse eye, Rat eye
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using GUCA1B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 3min.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using GUCA1B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 3min.)
Related Product Information for anti-GUCA1B antibody
The protein encoded by this gene is a calcium-binding protein that activates photoreceptor guanylate cyclases. This gene may have arisen due to a gene duplication event since there is a highly similar gene clustered with it on chromosome 6. Mutations in this gene can cause a form of retinitis pigmentosa.
Product Categories/Family for anti-GUCA1B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 23kDa
Observed: 23kDa
Observed: 23kDa
NCBI Official Full Name
guanylyl cyclase-activating protein 2
NCBI Official Synonym Full Names
guanylate cyclase activator 1B
NCBI Official Symbol
GUCA1B
NCBI Official Synonym Symbols
RP48; GCAP2; GUCA2
NCBI Protein Information
guanylyl cyclase-activating protein 2
UniProt Protein Name
Guanylyl cyclase-activating protein 2
Protein Family
UniProt Gene Name
GUCA1B
UniProt Synonym Gene Names
GCAP2; GCAP 2
NCBI Description
The protein encoded by this gene is a calcium-binding protein that activates photoreceptor guanylate cyclases. This gene may have arisen due to a gene duplication event since there is a highly similar gene clustered with it on chromosome 6. Mutations in this gene can cause a form of retinitis pigmentosa. [provided by RefSeq, Nov 2009]
Uniprot Description
Stimulates guanylyl cyclase 1 (GC1) and GC2 when free calcium ions concentration is low, and GC1 and GC2 when free calcium ions concentration is elevated. This Ca2+-sensitive regulation of GC is a key event in recovery of the dark state of rod photoreceptors following light exposure.MiscellaneousBinds three calcium ions.
Research Articles on GUCA1B
Similar Products
Product Notes
The GUCA1B guca1b (Catalog #AAA9134731) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GUCA1B Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GUCA1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the GUCA1B guca1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGQEFSWEEA EAAGEIDVAE LQEWYKKFVM ECPSGTLFMH EFKRFFKVTD DEEASQYVEG MFRAFDKNGD NTIDFLEYVA ALNLVLRGTL EHKLKWTFKI YDKDGNGCID RLELLNIVEG IYQLKKACRR ELQTEQGQLL TPEEVVDRIF LLVDENGDGQ LSLNEFVEGA RRDKWVMKML QMDMNPSSWL AQQRRKSAMF. It is sometimes possible for the material contained within the vial of "GUCA1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
