Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GHRH expression in transfected 293T cell line by GHRH polyclonal antibody. Lane 1: GHRH transfected lysate (12.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Growth Hormone Releasing Factor Polyclonal Antibody | anti-GHRF antibody

Growth Hormone Releasing Factor (GHRF, GRF, Growth Hormone Releasing Hormone, GHRH, MGC119781, Sermorelin, Somatocrinin, Somatoliberin, Somatorelin, MGC119781) (PE)

Gene Names
GHRH; GRF; INN; GHRF; MGC119781; GHRH
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Growth Hormone Releasing Factor; Polyclonal Antibody; Growth Hormone Releasing Factor (GHRF; GRF; Growth Hormone Releasing Hormone; GHRH; MGC119781; Sermorelin; Somatocrinin; Somatoliberin; Somatorelin; MGC119781) (PE); anti-GHRF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GHRH.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-GHRF antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GHRH, aa1-108 (NP_066567.1).
Immunogen Sequence
MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GHRH expression in transfected 293T cell line by GHRH polyclonal antibody. Lane 1: GHRH transfected lysate (12.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GHRH expression in transfected 293T cell line by GHRH polyclonal antibody. Lane 1: GHRH transfected lysate (12.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GHRF antibody
GHRH belongs to the glucagon family and is a preproprotein that is produced in the hypothalamus. The preproprotein is cleaved to form a 44 aa factor, also called somatocrinin, that acts to stimulate growth hormone release from the pituitary. Variant receptors for somatocrinin have been found in several types of tumors, and antagonists of these receptors can inhibit the growth of the tumors. Defects in this protein are a cause of dwarfism, while hypersecretion of the protein is a cause of gigantism.
Product Categories/Family for anti-GHRF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
somatoliberin isoform 1 preproprotein [Homo sapiens]
NCBI Official Synonym Full Names
growth hormone releasing hormone
NCBI Official Symbol
GHRH
NCBI Official Synonym Symbols
GRF; INN; GHRF; MGC119781; GHRH
NCBI Protein Information
somatoliberin; sermorelin; somatorelin; somatocrinin; OTTHUMP00000030915; growth hormone-releasing factor; growth hormone-releasing hormone
UniProt Protein Name
Somatoliberin
UniProt Gene Name
GHRH
UniProt Synonym Gene Names
GHRF; GRF; GHRH
UniProt Entry Name
SLIB_HUMAN

Uniprot Description

GHRH: GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone. Belongs to the glucagon family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 20q11.2

Cellular Component: extracellular space; extracellular region; terminal button

Molecular Function: growth hormone-releasing hormone activity; growth hormone-releasing hormone receptor binding

Biological Process: response to food; positive regulation of insulin-like growth factor receptor signaling pathway; positive regulation of growth hormone secretion; growth hormone secretion; cAMP-mediated signaling; positive regulation of circadian sleep/wake cycle, REM sleep; cell-cell signaling; positive regulation of cAMP biosynthetic process; positive regulation of cell proliferation; adenohypophysis development; positive regulation of multicellular organism growth; G-protein signaling, adenylate cyclase activating pathway

Similar Products

Product Notes

The GHRF ghrh (Catalog #AAA6380307) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Growth Hormone Releasing Factor (GHRF, GRF, Growth Hormone Releasing Hormone, GHRH, MGC119781, Sermorelin, Somatocrinin, Somatoliberin, Somatorelin, MGC119781) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Growth Hormone Releasing Factor can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GHRF ghrh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Growth Hormone Releasing Factor, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.