Mouse anti-Human UBR2 Monoclonal Antibody | anti-UBR2 antibody

UBR2 (E3 Ubiquitin-protein Ligase UBR2, C6orf133, KIAA0349, N-recognin-2, Ubiquitin-protein Ligase E3-alpha-2, Ubiquitin-protein Ligase E3-alpha-II) (PE)

Cat. Num. AAA6160958

• Gene Names: UBR2; C6orf133; bA49A4.1; dJ242G1.1; dJ392M17.3
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: UBR2; Monoclonal Antibody; UBR2 (E3 Ubiquitin-protein Ligase UBR2; C6orf133; KIAA0349; N-recognin-2; Ubiquitin-protein Ligase E3-alpha-2; Ubiquitin-protein Ligase E3-alpha-II) (PE); EC=6.3.2.-; bA49A4.1; dJ242G1.1; dJ392M17.3; RP3-392M17.3; anti-UBR2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G4
• Specificity: Recognizes human UBR2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 7898

• Applicable Applications for anti-UBR2 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-101 from UBR2 (NP_056070) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCG*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of UBR2 expression in transfected 293T cell line by UBR2 monoclonal antibody Lane 1: UBR2 transfected lysate (5kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to UBR2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged UBR2 is ~0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of UBR2 over-expressed 293 cell line, cotransfected with UBR2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with UBR2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-UBR2 antibody

Antibodies; Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 296317266
• NCBI GeneID: 23304
• NCBI Accession #: NM_015255.2
• NCBI GenBank Nucleotide #: NM_015255
• UniProt Accession #: Q8IWV8
• NCBI Official Full Name: Homo sapiens ubiquitin protein ligase E3 component n-recognin 2 (UBR2), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: ubiquitin protein ligase E3 component n-recognin 2
• NCBI Official Symbol: UBR2
• NCBI Official Synonym Symbols: C6orf133; bA49A4.1; dJ242G1.1; dJ392M17.3
• NCBI Protein Information: E3 ubiquitin-protein ligase UBR2
• UniProt Protein Name: E3 ubiquitin-protein ligase UBR2
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: UBR2
• UniProt Synonym Gene Names: C6orf133; KIAA0349
• UniProt Entry Name: UBR2_HUMAN

NCBI Description

This gene encodes an E3 ubiquitin ligase of the N-end rule proteolytic pathway that targets proteins with destabilizing N-terminal residues for polyubiquitylation and proteasome-mediated degradation. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Uniprot Description

UBR2: E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. Plays a critical role in chromatin inactivation and chromosome-wide transcriptional silencing during meiosis via ubiquitination of histone H2A. Binds leucine and is a negative regulator of the leucine-mTOR signaling pathway, thereby controlling cell growth. Belongs to the UBR1 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Ligase; EC 6.3.2.-; EC 6.3.2.19; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: nucleoplasm; plasma membrane; chromatin; ubiquitin ligase complex

Molecular Function: protein binding; zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; negative regulation of TOR signaling pathway; male meiosis I; chromatin silencing; spermatogenesis; histone H2A ubiquitination