Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GHRHSample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human GHRH Polyclonal Antibody | anti-GHRH antibody

GHRH Antibody - middle region

Gene Names
GHRH; GRF; INN; GHRF
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GHRH; Polyclonal Antibody; GHRH Antibody - middle region; anti-GHRH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVA
Sequence Length
108
Applicable Applications for anti-GHRH antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GHRH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GHRHSample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GHRHSample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GHRH antibody
This gene encodes a member of the glucagon family of proteins. The encoded preproprotein is produced in the hypothalamus and cleaved to generate the mature factor, known as somatoliberin, which acts to stimulate growth hormone release from the pituitary gland. Variant receptors for somatoliberin have been found in several types of tumors, and antagonists of these receptors can inhibit the growth of the tumors. Defects in this gene are a cause of dwarfism, while hypersecretion of the encoded protein is a cause of gigantism. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed.
Product Categories/Family for anti-GHRH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11 kDa
NCBI Official Full Name
somatoliberin isoform 2 preproprotein
NCBI Official Synonym Full Names
growth hormone releasing hormone
NCBI Official Symbol
GHRH
NCBI Official Synonym Symbols
GRF; INN; GHRF
NCBI Protein Information
somatoliberin
UniProt Protein Name
Somatoliberin
Protein Family
UniProt Gene Name
GHRH
UniProt Synonym Gene Names
GHRF; GRF; GHRH
UniProt Entry Name
SLIB_HUMAN

NCBI Description

This gene encodes a member of the glucagon family of proteins. The encoded preproprotein is produced in the hypothalamus and cleaved to generate the mature factor, known as somatoliberin, which acts to stimulate growth hormone release from the pituitary gland. Variant receptors for somatoliberin have been found in several types of tumors, and antagonists of these receptors can inhibit the growth of the tumors. Defects in this gene are a cause of dwarfism, while hypersecretion of the encoded protein is a cause of gigantism. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016]

Uniprot Description

GHRH: GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone. Belongs to the glucagon family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 20q11.2

Cellular Component: extracellular space; extracellular region; terminal button

Molecular Function: growth hormone-releasing hormone activity; growth hormone-releasing hormone receptor binding

Biological Process: response to food; positive regulation of insulin-like growth factor receptor signaling pathway; positive regulation of growth hormone secretion; growth hormone secretion; cAMP-mediated signaling; positive regulation of circadian sleep/wake cycle, REM sleep; cell-cell signaling; positive regulation of cAMP biosynthetic process; positive regulation of cell proliferation; adenohypophysis development; positive regulation of multicellular organism growth; G-protein signaling, adenylate cyclase activating pathway

Research Articles on GHRH

Similar Products

Product Notes

The GHRH ghrh (Catalog #AAA3221367) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GHRH Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GHRH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GHRH ghrh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSARKLLQDI MSRQQGESNQ ERGARARLGR QVDSMWAEQK QMELESILVA. It is sometimes possible for the material contained within the vial of "GHRH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.