Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GREM2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysate)

Rabbit GREM2 Polyclonal Antibody | anti-GREM2 antibody

GREM2 antibody - N-terminal region

Gene Names
GREM2; PRDC; DAND3; STHAG9; CKTSF1B2
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GREM2; Polyclonal Antibody; GREM2 antibody - N-terminal region; anti-GREM2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIK
Sequence Length
168
Applicable Applications for anti-GREM2 antibody
Western Blot (WB)
Homology
Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GREM2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GREM2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysate)

Western Blot (WB) (WB Suggested Anti-GREM2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysate)
Related Product Information for anti-GREM2 antibody
This is a rabbit polyclonal antibody against GREM2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted glycosylated protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation.
Product Categories/Family for anti-GREM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
gremlin-2
NCBI Official Synonym Full Names
gremlin 2, DAN family BMP antagonist
NCBI Official Symbol
GREM2
NCBI Official Synonym Symbols
PRDC; DAND3; STHAG9; CKTSF1B2
NCBI Protein Information
gremlin-2
UniProt Protein Name
Gremlin-2
Protein Family
UniProt Gene Name
GREM2
UniProt Synonym Gene Names
CKTSF1B2; DAND3; PRDC
UniProt Entry Name
GREM2_HUMAN

NCBI Description

This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted glycosylated protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation. [provided by RefSeq, Jul 2008]

Uniprot Description

GREM2: Cytokine that inhibits the activity of BMP2 and BMP4 in a dose-dependent manner. Antagonized BMP4-induced suppression of progesterone production in granulosa cells. Belongs to the DAN family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 1q43

Cellular Component: extracellular space; extracellular region

Molecular Function: heparin binding; protein homodimerization activity; cytokine activity

Biological Process: BMP signaling pathway; embryonic body morphogenesis; cytokine and chemokine mediated signaling pathway; determination of dorsal identity

Research Articles on GREM2

Similar Products

Product Notes

The GREM2 grem2 (Catalog #AAA3213471) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GREM2 antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GREM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GREM2 grem2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MFWKLSLSLF LVAVLVKVAE ARKNRPAGAI PSPYKDGSSN NSERWQHQIK. It is sometimes possible for the material contained within the vial of "GREM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.