Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Muscle )

Rabbit GPT Polyclonal Antibody | anti-GPT antibody

GPT antibody - N-terminal region

Gene Names
GPT; AAT1; ALT1; GPT1
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
GPT; Polyclonal Antibody; GPT antibody - N-terminal region; anti-GPT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT
Sequence Length
496
Applicable Applications for anti-GPT antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GPT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Muscle )

Immunohistochemistry (IHC) (Human Muscle )

Western Blot (WB)

(WB Suggested Anti-GPT Antibody Titration: 5.0ug/mlPositive Control: Fetal liver cell lysate)

Western Blot (WB) (WB Suggested Anti-GPT Antibody Titration: 5.0ug/mlPositive Control: Fetal liver cell lysate)
Related Product Information for anti-GPT antibody
This is a rabbit polyclonal antibody against GPT. It was validated on Western Blot and immunohistochemistry

Target Description: GPT participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
alanine aminotransferase 1
NCBI Official Synonym Full Names
glutamic--pyruvic transaminase
NCBI Official Symbol
GPT
NCBI Official Synonym Symbols
AAT1; ALT1; GPT1
NCBI Protein Information
alanine aminotransferase 1
UniProt Protein Name
Alanine aminotransferase 1
Protein Family
UniProt Gene Name
GPT
UniProt Synonym Gene Names
AAT1; GPT1; ALT1; GPT 1
UniProt Entry Name
ALAT1_HUMAN

NCBI Description

This gene encodes cytosolic alanine aminotransaminase 1 (ALT1); also known as glutamate-pyruvate transaminase 1. This enzyme catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate and, therefore, plays a key role in the intermediary metabolism of glucose and amino acids. Serum activity levels of this enzyme are routinely used as a biomarker of liver injury caused by drug toxicity, infection, alcohol, and steatosis. A related gene on chromosome 16 encodes a putative mitochondrial alanine aminotransaminase.[provided by RefSeq, Nov 2009]

Uniprot Description

GPT: Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. Participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles. Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. Alanine aminotransferase subfamily.

Protein type: Amino Acid Metabolism - alanine, aspartate and glutamate; EC 2.6.1.2; Transferase

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: cytosol

Molecular Function: alanine transaminase activity; pyridoxal phosphate binding

Biological Process: amino acid biosynthetic process; L-alanine catabolic process

Research Articles on GPT

Similar Products

Product Notes

The GPT gpt (Catalog #AAA3207878) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPT antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GPT can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GPT gpt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RRVEYAVRGP IVQRALELEQ ELRQGVKKPF TEVIRANIGD AQAMGQRPIT. It is sometimes possible for the material contained within the vial of "GPT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.