Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against immunogen using 133345 (34.87kD).)

Mouse anti-Human SIGLEC6 Monoclonal Antibody | anti-SIGLEC6 antibody

SIGLEC6 (Sialic Acid binding Ig-like Lectin 6, Siglec-6, Obesity-binding Protein 1, OB-BP1, CD33 Antigen-like 1, CDw327, CD327, CD33L, CD33L1, OBBP1) (Biotin)

Gene Names
SIGLEC6; CD327; CD33L; OBBP1; CD33L1; CD33L2; CDW327
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SIGLEC6; Monoclonal Antibody; SIGLEC6 (Sialic Acid binding Ig-like Lectin 6; Siglec-6; Obesity-binding Protein 1; OB-BP1; CD33 Antigen-like 1; CDw327; CD327; CD33L; CD33L1; OBBP1) (Biotin); anti-SIGLEC6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2G6
Specificity
Recognizes human Siglec 6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SIGLEC6 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa371-453 from human Siglec 6 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen using 133345 (34.87kD).)

Western Blot (WB) (Western Blot detection against immunogen using 133345 (34.87kD).)

Western Blot (WB)

(Western Blot analysis of Siglec 6 expression in transfected 293T cell line using 133345. Lane 1: SIGLEC6 transfected lysate (48.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of Siglec 6 expression in transfected 293T cell line using 133345. Lane 1: SIGLEC6 transfected lysate (48.3kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of Siglec 6 transfected lysate using 133345 and Protein A Magnetic Bead and immunoblotted with SIGLEC6 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of Siglec 6 transfected lysate using 133345 and Protein A Magnetic Bead and immunoblotted with SIGLEC6 rabbit polyclonal antibody.)
Related Product Information for anti-SIGLEC6 antibody
SIGLEC6 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells by binding to alpha2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. SIGLEC6, which interacts with LEP, is expressed at high levels in placenta (cyto-and syncytiotrophoblastic cells) and at lower levels in spleen, peripheral blood leukocytes (predominantly B-cells) and small intestine. It contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in downmodulation of cellular responses. The phosphorylated ITIM motif binds to the SH2 domain of PTPN6/SHP-1. The gene for SIGLEC6 belongs to the immunoglobulin superfamily.
Product Categories/Family for anti-SIGLEC6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
946
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62.6kDa (563aa) 70-100KDa (SDS-PAGE under reducing conditions.)
NCBI Official Full Name
sialic acid-binding Ig-like lectin 6 isoform 1
NCBI Official Synonym Full Names
sialic acid binding Ig like lectin 6
NCBI Official Symbol
SIGLEC6
NCBI Official Synonym Symbols
CD327; CD33L; OBBP1; CD33L1; CD33L2; CDW327
NCBI Protein Information
sialic acid-binding Ig-like lectin 6
UniProt Protein Name
Sialic acid-binding Ig-like lectin 6
UniProt Gene Name
SIGLEC6
UniProt Synonym Gene Names
CD33L; CD33L1; OBBP1; Siglec-6; OB-BP1

NCBI Description

This gene encodes a member of the SIGLEC (sialic acid binding immunoglobulin-like lectin) family of proteins. The encoded transmembrane receptor binds sialyl-TN glycans and leptin. Placental expression of the encoded protein is upregulated in preeclampsia. [provided by RefSeq, Jul 2016]

Uniprot Description

Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.

Research Articles on SIGLEC6

Similar Products

Product Notes

The SIGLEC6 siglec6 (Catalog #AAA6144358) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SIGLEC6 (Sialic Acid binding Ig-like Lectin 6, Siglec-6, Obesity-binding Protein 1, OB-BP1, CD33 Antigen-like 1, CDw327, CD327, CD33L, CD33L1, OBBP1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SIGLEC6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SIGLEC6 siglec6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SIGLEC6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.