Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using GPR62 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

Rabbit GPR62 Polyclonal Antibody | anti-GPR62 antibody

GPR62 Rabbit pAb

Gene Names
GPR62; GPCR8; KPG_005
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
GPR62; Polyclonal Antibody; GPR62 Rabbit pAb; GPCR8; KPG_005; anti-GPR62 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
GTPPAPPPAPARCSVLAGGLGPFRPLWALLAFALPALLLLGAYGGIFVVARRAALRPPRPARGSRLHSDSLDSRLSILPPLRPRLPGGKAALAPALAVGQF
Applicable Applications for anti-GPR62 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human GPR62 (NP_543141.3).
Cellular Location
Cell membrane, Multi-pass membrane protein
Positive Samples
U-87MG, Mouse testis, Rat testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using GPR62 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using GPR62 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Product Categories/Family for anti-GPR62 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,614 Da
NCBI Official Full Name
probable G-protein coupled receptor 62
NCBI Official Synonym Full Names
G protein-coupled receptor 62
NCBI Official Symbol
GPR62
NCBI Official Synonym Symbols
GPCR8; KPG_005
NCBI Protein Information
probable G-protein coupled receptor 62; hGPCR8; G-protein coupled receptor GPCR8; G-protein coupled receptor KPG_005
UniProt Protein Name
Probable G-protein coupled receptor 62
UniProt Gene Name
GPR62
UniProt Synonym Gene Names
hGPCR8
UniProt Entry Name
GPR62_HUMAN

Uniprot Description

GPR62: Orphan receptor. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1; Receptor, GPCR

Chromosomal Location of Human Ortholog: 3p21.1

Cellular Component: plasma membrane; integral to membrane; receptor complex

Molecular Function: G-protein coupled receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway

Similar Products

Product Notes

The GPR62 gpr62 (Catalog #AAA9142200) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPR62 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GPR62 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the GPR62 gpr62 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GTPPAPPPAP ARCSVLAGGL GPFRPLWALL AFALPALLLL GAYGGIFVVA RRAALRPPRP ARGSRLHSDS LDSRLSILPP LRPRLPGGKA ALAPALAVGQ F. It is sometimes possible for the material contained within the vial of "GPR62, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.