Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: USF2Sample Tissue: Mouse Stomach lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse USF2 Polyclonal Antibody | anti-USF2 antibody

USF2 Antibody - middle region

Gene Names
Usf2; Usf-2; bHLHb12
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
USF2; Polyclonal Antibody; USF2 Antibody - middle region; anti-USF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GTRTPRDERRRAQHNEVERRRRDKINNWIVQLSKIIPDCHADNSKTGASK
Sequence Length
346
Applicable Applications for anti-USF2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse USF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: USF2Sample Tissue: Mouse Stomach lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: USF2Sample Tissue: Mouse Stomach lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-USF2 antibody
Transcription factor that binds to a symmetrical DNA sequence (E-boxes) (5'-CACGTG-3') that is found in a variety of viral and cellular promoters.
Product Categories/Family for anti-USF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
upstream stimulatory factor 2
NCBI Official Synonym Full Names
upstream transcription factor 2
NCBI Official Symbol
Usf2
NCBI Official Synonym Symbols
Usf-2; bHLHb12
NCBI Protein Information
upstream stimulatory factor 2
UniProt Protein Name
Upstream stimulatory factor 2
UniProt Gene Name
Usf2
UniProt Entry Name
USF2_MOUSE

Uniprot Description

USF2: Transcription factor that binds to a symmetrical DNA sequence (E-boxes) (5'-CACGTG-3') that is found in a variety of viral and cellular promoters. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Cellular Component: nucleoplasm; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein dimerization activity; protein binding; protein homodimerization activity; DNA binding; protein heterodimerization activity; sequence-specific DNA binding; double-stranded DNA binding; bHLH transcription factor binding; transcription factor activity

Biological Process: lactation; regulation of transcription from RNA polymerase II promoter; transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; lipid homeostasis; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription from RNA polymerase II promoter by glucose

Research Articles on USF2

Similar Products

Product Notes

The USF2 usf2 (Catalog #AAA3224255) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The USF2 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's USF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the USF2 usf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GTRTPRDERR RAQHNEVERR RRDKINNWIV QLSKIIPDCH ADNSKTGASK. It is sometimes possible for the material contained within the vial of "USF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.