Western Blot (WB)
(Host: RabbitTarget Name: KLHL1Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlKLHL1 is supported by BioGPS gene expression data to be expressed in 721_B)
Rabbit KLHL1 Polyclonal Antibody | anti-KLHL1 antibody
KLHL1 antibody - middle region
Gene Names
KLHL1; MRP2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KLHL1; Polyclonal Antibody; KLHL1 antibody - middle region; anti-KLHL1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: APLSMPRDAVGVCLLGDRLYAVGGYDGQTYLNTMESYDPQTNEWTQMASL
Sequence Length
748
Applicable Applications for anti-KLHL1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 79%; Zebrafish: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KLHL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: KLHL1Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlKLHL1 is supported by BioGPS gene expression data to be expressed in 721_B)
Western Blot (WB)
(Host: RabbitTarget Name: KLHL1Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlKLHL1 is supported by BioGPS gene expression data to be expressed in 721_B)
Western Blot (WB)
(WB Suggested Anti-KLHL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateKLHL1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Western Blot (WB)
(WB Suggested Anti-KLHL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateKLHL1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-KLHL1 antibody
This is a rabbit polyclonal antibody against KLHL1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: KLHL1 contains 6 Kelch repeats and 1 BTB (POZ) domain..It is highly expressed in brain. KLHL1 may play a role in organizing the actin cytoskeleton of the brain cells.
Target Description: KLHL1 contains 6 Kelch repeats and 1 BTB (POZ) domain..It is highly expressed in brain. KLHL1 may play a role in organizing the actin cytoskeleton of the brain cells.
Product Categories/Family for anti-KLHL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
kelch-like protein 1 isoform 1
NCBI Official Synonym Full Names
kelch like family member 1
NCBI Official Symbol
KLHL1
NCBI Official Synonym Symbols
MRP2
NCBI Protein Information
kelch-like protein 1
UniProt Protein Name
Kelch-like protein 1
Protein Family
UniProt Gene Name
KLHL1
UniProt Synonym Gene Names
KIAA1490
UniProt Entry Name
KLHL1_HUMAN
NCBI Description
The KLHL1 protein belongs to a family of actin-organizing proteins related to Drosophila Kelch (Nemes et al., 2000 [PubMed 10888605]).[supplied by OMIM, Feb 2010]
Uniprot Description
KLHL1: May play a role in organizing the actin cytoskeleton of the brain cells.
Chromosomal Location of Human Ortholog: 13q21
Cellular Component: cytoskeleton; cell soma; cytoplasm; dendrite
Molecular Function: actin binding
Biological Process: cerebellar Purkinje cell layer development; dendrite development; actin cytoskeleton organization and biogenesis; adult walking behavior
Research Articles on KLHL1
Similar Products
Product Notes
The KLHL1 klhl1 (Catalog #AAA3204631) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLHL1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KLHL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KLHL1 klhl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: APLSMPRDAV GVCLLGDRLY AVGGYDGQTY LNTMESYDPQ TNEWTQMASL. It is sometimes possible for the material contained within the vial of "KLHL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
