Rabbit GLUD1 Polyclonal Antibody | anti-GLUD1 antibody

GLUD1 antibody - N-terminal region

Cat. Num. AAA3207876

• Gene Names: GLUD1; GDH; GDH1; GLUD
• Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep, Yeast, Zebrafish
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: GLUD1; Polyclonal Antibody; GLUD1 antibody - N-terminal region; anti-GLUD1 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep, Yeast, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF
• Sequence Length: 558

• Applicable Applications for anti-GLUD1 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 86%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 100%; Sheep: 86%; Yeast: 86%; Zebrafish: 83%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLUD1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with CORTEX/KIDNEY tissue)

Immunohistochemistry (IHC)

(Immunohistochemistry with PFA fixed human colon tissue tissue)

Immunohistochemistry (IHC)

(Immunohistochemistry with pFA fixed human pancreas tissue tissue)

Western Blot (WB)

(GLUD1 antibody - N-terminal region validated by WB using HT1080 cell lysate at 1ug/ml.GLUD1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells)

Related Product Information for anti-GLUD1 antibody

This is a rabbit polyclonal antibody against GLUD1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate. Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification. L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate (Smith et al., 2001 [PubMed 11254391]). Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification (Mavrothalassitis et al., 1988 [PubMed 3368458]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-51 M20867.1 1-51 52-3120 BC112946.1 16-3084

Product Categories/Family for anti-GLUD1 antibody

Polyclonal; Signal Proteins; Lymphocyte Signaling; Membrane Protein; Drugs and Drug Metabolism; Developmental Biology; Immunohistochemistry; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 4885281
• NCBI GeneID: 2746
• NCBI Accession #: NP_005262
• NCBI GenBank Nucleotide #: NM_005271
• UniProt Accession #: P00367
• Molecular Weight: 56kDa
• NCBI Official Full Name: glutamate dehydrogenase 1, mitochondrial isoform a
• NCBI Official Synonym Full Names: glutamate dehydrogenase 1
• NCBI Official Symbol: GLUD1
• NCBI Official Synonym Symbols: GDH; GDH1; GLUD
• NCBI Protein Information: glutamate dehydrogenase 1, mitochondrial
• UniProt Protein Name: Glutamate dehydrogenase 1, mitochondrial
• UniProt Gene Name: GLUD1
• UniProt Synonym Gene Names: GLUD; GDH 1

NCBI Description

This gene encodes glutamate dehydrogenase, which is a mitochondrial matrix enzyme that catalyzes the oxidative deamination of glutamate to alpha-ketoglutarate and ammonia. This enzyme has an important role in regulating amino acid-induced insulin secretion. It is allosterically activated by ADP and inhibited by GTP and ATP. Activating mutations in this gene are a common cause of congenital hyperinsulinism. Alternative splicing of this gene results in multiple transcript variants. The related glutamate dehydrogenase 2 gene on the human X-chromosome originated from this gene via retrotransposition and encodes a soluble form of glutamate dehydrogenase. Related pseudogenes have been identified on chromosomes 10, 18 and X. [provided by RefSeq, Jan 2016]

Uniprot Description

Mitochondrial glutamate dehydrogenase that converts L-glutamate into alpha-ketoglutarate. Plays a key role in glutamine anaplerosis by producing alpha-ketoglutarate, an important intermediate in the tricarboxylic acid cycle. May be involved in learning and memory reactions by increasing the turnover of the excitatory neurotransmitter glutamate ().