Western Blot (WB)
(WB Suggested Anti-GLUD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Rabbit anti-Human GLUD2 Polyclonal Antibody | anti-GLUD2 antibody
GLUD2 antibody - N-terminal region
Gene Names
GLUD2; GDH2; GLUDP1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GLUD2; Polyclonal Antibody; GLUD2 antibody - N-terminal region; anti-GLUD2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAAR
Sequence Length
558
Applicable Applications for anti-GLUD2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GLUD2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-GLUD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Western Blot (WB)
(WB Suggested Anti-GLUD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Related Product Information for anti-GLUD2 antibody
This is a rabbit polyclonal antibody against GLUD2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors.Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors. See also GLUD1 (MIM 138130).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2348 BC050732.2 1-2348
Target Description: Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors.Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors. See also GLUD1 (MIM 138130).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2348 BC050732.2 1-2348
Product Categories/Family for anti-GLUD2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
glutamate dehydrogenase 2, mitochondrial
NCBI Official Synonym Full Names
glutamate dehydrogenase 2
NCBI Official Symbol
GLUD2
NCBI Official Synonym Symbols
GDH2; GLUDP1
NCBI Protein Information
glutamate dehydrogenase 2, mitochondrial
UniProt Protein Name
Glutamate dehydrogenase 2, mitochondrial
UniProt Gene Name
GLUD2
UniProt Synonym Gene Names
GLUDP1; GDH 2
UniProt Entry Name
DHE4_HUMAN
NCBI Description
The protein encoded by this gene is localized to the mitochondrion and acts as a homohexamer to recycle glutamate during neurotransmission. The encoded enzyme catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate. This gene is intronless.[provided by RefSeq, Jan 2010]
Uniprot Description
Function: Important for recycling the chief excitatory neurotransmitter, glutamate, during neurotransmission.
Catalytic activity: L-glutamate + H2O + NAD(P)+ = 2-oxoglutarate + NH3 + NAD(P)H.
Subunit structure: Homohexamer
By similarity.
Subcellular location: Mitochondrion matrix Ref.7.
Tissue specificity: Expressed in retina, testis and, at a lower level, brain.
Post-translational modification: Stoichiometry shows that ADP-ribosylation occurs in one subunit per catalytically active homohexamer.
Sequence similarities: Belongs to the Glu/Leu/Phe/Val dehydrogenases family.
Research Articles on GLUD2
Similar Products
Product Notes
The GLUD2 glud2 (Catalog #AAA3211886) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GLUD2 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GLUD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GLUD2 glud2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MYRYLAKALL PSRAGPAALG SAANHSAALL GRGRGQPAAA SQPGLALAAR. It is sometimes possible for the material contained within the vial of "GLUD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
