Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type: Rat kidneyACO2 antibody - N-terminal region validated by WB using Proximal kidney tubules purfied from cortex at 5.0ug/ml.)

Rabbit ACO2 Polyclonal Antibody | anti-ACO2 antibody

ACO2 antibody - N-terminal region

Gene Names
ACO2; ICRD; OCA8; OPA9; ACONM; HEL-S-284
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ACO2; Polyclonal Antibody; ACO2 antibody - N-terminal region; anti-ACO2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATA
Sequence Length
780
Applicable Applications for anti-ACO2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ACO2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: Rat kidneyACO2 antibody - N-terminal region validated by WB using Proximal kidney tubules purfied from cortex at 5.0ug/ml.)

Western Blot (WB) (Sample Type: Rat kidneyACO2 antibody - N-terminal region validated by WB using Proximal kidney tubules purfied from cortex at 5.0ug/ml.)

Western Blot (WB)

(WB Suggested Anti-ACO2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateACO2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (WB Suggested Anti-ACO2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateACO2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-ACO2 antibody
This is a rabbit polyclonal antibody against ACO2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ACO2 belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-ACO2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
50
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
aconitate hydratase, mitochondrial
NCBI Official Synonym Full Names
aconitase 2
NCBI Official Symbol
ACO2
NCBI Official Synonym Symbols
ICRD; OCA8; OPA9; ACONM; HEL-S-284
NCBI Protein Information
aconitate hydratase, mitochondrial
UniProt Protein Name
Aconitate hydratase, mitochondrial
Protein Family
UniProt Gene Name
ACO2
UniProt Synonym Gene Names
Aconitase
UniProt Entry Name
ACON_HUMAN

NCBI Description

The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification. [provided by RefSeq, Jul 2008]

Uniprot Description

ACO2: Catalyzes the isomerization of citrate to isocitrate via cis-aconitate. Monomer. Belongs to the aconitase/IPM isomerase family.

Protein type: Lyase; EC 4.2.1.3; Carbohydrate Metabolism - glyoxylate and dicarboxylate; Carbohydrate Metabolism - citrate (TCA) cycle; Mitochondrial

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: mitochondrion; mitochondrial matrix; nucleus

Molecular Function: iron ion binding; 4 iron, 4 sulfur cluster binding; aconitate hydratase activity; 3 iron, 4 sulfur cluster binding

Biological Process: isocitrate metabolic process; cellular metabolic process; generation of precursor metabolites and energy; tricarboxylic acid cycle; citrate metabolic process

Disease: Infantile Cerebellar-retinal Degeneration; Optic Atrophy 8

Research Articles on ACO2

Similar Products

Product Notes

The ACO2 aco2 (Catalog #AAA3212689) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACO2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's ACO2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACO2 aco2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQFISSGLSK VAVPSTIHCD HLIEAQVGGE KDLRRAKDIN QEVYNFLATA. It is sometimes possible for the material contained within the vial of "ACO2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.