Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GLIS2 Antibody Titration: 2.5ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

Rabbit GLIS2 Polyclonal Antibody | anti-GLIS2 antibody

GLIS2 antibody - N-terminal region

Gene Names
GLIS2; NKL; NPHP7
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
GLIS2; Polyclonal Antibody; GLIS2 antibody - N-terminal region; anti-GLIS2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQF
Sequence Length
524
Applicable Applications for anti-GLIS2 antibody
Western Blot (WB)
Homology
Dog: 92%; Guinea Pig: 86%; Horse: 77%; Human: 100%; Mouse: 83%; Rabbit: 85%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GLIS2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GLIS2 Antibody Titration: 2.5ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-GLIS2 Antibody Titration: 2.5ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)
Related Product Information for anti-GLIS2 antibody
This is a rabbit polyclonal antibody against GLIS2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription.[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
zinc finger protein GLIS2
NCBI Official Synonym Full Names
GLIS family zinc finger 2
NCBI Official Symbol
GLIS2
NCBI Official Synonym Symbols
NKL; NPHP7
NCBI Protein Information
zinc finger protein GLIS2
UniProt Protein Name
Zinc finger protein GLIS2
Protein Family
UniProt Gene Name
GLIS2
UniProt Synonym Gene Names
NKL
UniProt Entry Name
GLIS2_HUMAN

NCBI Description

This gene is a member of the GLI-similar zinc finger protein family and encodes a nuclear transcription factor with five C2H2-type zinc finger domains. The protein encoded by this gene is widely expressed at low levels in the neural tube and peripheral nervous system and likely promotes neuronal differentiation. It is abundantly expressed in the kidney and may have a role in the regulation of kidney morphogenesis. p120 regulates the expression level of this protein and induces the cleavage of this protein's C-terminal zinc finger domain. This protein also promotes the nuclear translocation of p120. Mutations in this gene cause nephronophthisis (NPHP), an autosomal recessive kidney disease characterized by tubular basement membrane disruption, interstitial lymphohistiocytic cell infiltration, and development of cysts at the corticomedullary border of the kidneys.[provided by RefSeq, Jan 2010]

Uniprot Description

GLIS2: Can act either as a transcriptional repressor or as a transcriptional activator, depending on the cell context. Acts as a repressor of the Hedgehog signaling pathway. Represses the Hedgehog-dependent expression of Wnt4. Necessary to maintain the differentiated epithelial phenotype in renal cells through the inhibition of SNAI1, which itself induces the epithelial-to-mesenchymal transition. Represses transcriptional activation mediated by CTNNB1 in the Wnt signaling pathway. May act by recruiting the corepressors CTBP1 and HDAC3. May be involved in neuron differentiation. Defects in GLIS2 are the cause of nephronophthisis type 7 (NPHP7). NPHP7 is an autosomal recessive disorder resulting in end-stage renal disease during childhood or adolescence. It is a progressive tubulo-interstitial kidney disorder histologically characterized by modifications of the tubules with thickening of the basement membrane, interstitial fibrosis and, in the advanced stages, medullary cysts. Belongs to the GLI C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: cytoplasm; nuclear speck; nucleus

Molecular Function: protein binding; metal ion binding

Biological Process: nervous system development; transcription, DNA-dependent; negative regulation of transcription factor activity; negative regulation of smoothened signaling pathway; positive regulation of transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; cell differentiation

Disease: Nephronophthisis 7

Research Articles on GLIS2

Similar Products

Product Notes

The GLIS2 glis2 (Catalog #AAA3200138) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GLIS2 antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GLIS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GLIS2 glis2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSPPSGLDSP NGSSSLSPER QGNGDLPPVP SASDFQPLRY LDGVPSSFQF. It is sometimes possible for the material contained within the vial of "GLIS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.