Western Blot (WB)
(WB Suggested Anti-KLF10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)
Rabbit KLF10 Polyclonal Antibody | anti-KLF10 antibody
KLF10 antibody - N-terminal region
Gene Names
KLF10; EGRA; TIEG; TIEG1; EGR-alpha
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KLF10; Polyclonal Antibody; KLF10 antibody - N-terminal region; anti-KLF10 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPY
Sequence Length
469
Applicable Applications for anti-KLF10 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 86%; Guinea Pig: 83%; Horse: 86%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 93%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KLF10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-KLF10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)
Western Blot (WB)
(WB Suggested Anti-KLF10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)
Related Product Information for anti-KLF10 antibody
This is a rabbit polyclonal antibody against KLF10. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: KLF10 is a transcriptional repressor involved in the regulation of cell growth. KLF10 binds to the consensus sequence 5'-GGTGTG-3'.
Target Description: KLF10 is a transcriptional repressor involved in the regulation of cell growth. KLF10 binds to the consensus sequence 5'-GGTGTG-3'.
Product Categories/Family for anti-KLF10 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51kDa
NCBI Official Full Name
Krueppel-like factor 10 isoform b
NCBI Official Synonym Full Names
Kruppel like factor 10
NCBI Official Symbol
KLF10
NCBI Official Synonym Symbols
EGRA; TIEG; TIEG1; EGR-alpha
NCBI Protein Information
Krueppel-like factor 10
UniProt Protein Name
Early growth response protein alpha
Protein Family
UniProt Gene Name
KLF10
UniProt Synonym Gene Names
EGR alpha
UniProt Entry Name
O75411_HUMAN
NCBI Description
This gene encodes a member of a family of proteins that feature C2H2-type zinc finger domains. The encoded protein is a transcriptional repressor that acts as an effector of transforming growth factor beta signaling. Activity of this protein may inhibit the growth of cancers, particularly pancreatic cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]
Research Articles on KLF10
Similar Products
Product Notes
The KLF10 klf10 (Catalog #AAA3201534) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLF10 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KLF10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KLF10 klf10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SMSCSWKSDF KKYVENRPVT PVSDLSEEEN LLPGTPDFHT IPAFCLTPPY. It is sometimes possible for the material contained within the vial of "KLF10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
