Western Blot (WB)
(WB Suggested Anti-Ghitm Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Liver)
Rabbit Ghitm Polyclonal Antibody | anti-GHITM antibody
Ghitm antibody - middle region
Gene Names
Ghitm; MICS1; C77840; PTD010; Tmbim5; 1010001P14Rik
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Ghitm; Polyclonal Antibody; Ghitm antibody - middle region; anti-GHITM antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WVTIGATFAAMIGAGMLVHSISYEQSPGPKHLAWMLHSGVMGAVVAPLTI
Sequence Length
346
Applicable Applications for anti-GHITM antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Goat: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Ghitm Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Liver)
Western Blot (WB)
(WB Suggested Anti-Ghitm Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Liver)
Related Product Information for anti-GHITM antibody
This is a rabbit polyclonal antibody against Ghitm. It was validated on Western Blot
Target Description: Ghitm is required for the mitochondrial tubular network and cristae organization. Ghitm is involved in apoptotic release of cytochrome c.
Target Description: Ghitm is required for the mitochondrial tubular network and cristae organization. Ghitm is involved in apoptotic release of cytochrome c.
Product Categories/Family for anti-GHITM antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
growth hormone-inducible transmembrane protein
NCBI Official Synonym Full Names
growth hormone inducible transmembrane protein
NCBI Official Symbol
Ghitm
NCBI Official Synonym Symbols
MICS1; C77840; PTD010; Tmbim5; 1010001P14Rik
NCBI Protein Information
growth hormone-inducible transmembrane protein
UniProt Protein Name
Growth hormone-inducible transmembrane protein
Protein Family
UniProt Gene Name
Ghitm
UniProt Synonym Gene Names
Mics1; MICS1
UniProt Entry Name
GHITM_MOUSE
Uniprot Description
GHITM: Required for the mitochondrial tubular network and cristae organization. Involved in apoptotic release of cytochrome c. Belongs to the BI1 family.
Protein type: Membrane protein, multi-pass; Membrane protein, integral; Mitochondrial
Cellular Component: membrane; mitochondrion; mitochondrial inner membrane; integral to membrane
Biological Process: apoptosis
Similar Products
Product Notes
The GHITM ghitm (Catalog #AAA3208405) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ghitm antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Ghitm can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GHITM ghitm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WVTIGATFAA MIGAGMLVHS ISYEQSPGPK HLAWMLHSGV MGAVVAPLTI. It is sometimes possible for the material contained within the vial of "Ghitm, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
