Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GCG Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

Rabbit GCG Polyclonal Antibody | anti-GCG antibody

GCG antibody - N-terminal region

Gene Names
GCG; GLP1; GLP2; GRPP; GLP-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
GCG; Polyclonal Antibody; GCG antibody - N-terminal region; anti-GCG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK
Sequence Length
180
Applicable Applications for anti-GCG antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GCG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GCG Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-GCG Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-GCG antibody
This is a rabbit polyclonal antibody against GCG. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
glucagon preproprotein
NCBI Official Synonym Full Names
glucagon
NCBI Official Symbol
GCG
NCBI Official Synonym Symbols
GLP1; GLP2; GRPP; GLP-1
NCBI Protein Information
glucagon
UniProt Protein Name
Glucagon
Protein Family
UniProt Gene Name
GCG
UniProt Synonym Gene Names
GRPP; OXM; OXY; GLP-1; GLP-1(7-37); GLP-1(7-36); GLP-2
UniProt Entry Name
GLUC_HUMAN

NCBI Description

The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq, Jul 2008]

Uniprot Description

GCG: Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes. Glucagon release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. GLP-1 and GLP-2 are induced in response to nutrient ingestion. Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain. Belongs to the glucagon family.

Protein type: Hormone; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 2q36-q37

Cellular Component: extracellular space; endoplasmic reticulum lumen; extracellular region; plasma membrane

Molecular Function: identical protein binding; protein binding; hormone activity; glucagon receptor binding; receptor binding

Biological Process: positive regulation of protein binding; positive regulation of histone H3-K4 methylation; signal transduction; positive regulation of peptidyl-serine phosphorylation; G-protein signaling, coupled to cAMP nucleotide second messenger; response to starvation; G-protein coupled receptor protein signaling pathway; cell proliferation; cellular protein metabolic process; positive regulation of protein kinase activity; positive regulation of cAMP biosynthetic process; energy reserve metabolic process; feeding behavior; regulation of insulin secretion; negative regulation of apoptosis

Research Articles on GCG

Similar Products

Product Notes

The GCG gcg (Catalog #AAA3206155) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GCG antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GCG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GCG gcg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSDPDQMNED KRHSQGTFTS DYSKYLDSRR AQDFVQWLMN TKRNRNNIAK. It is sometimes possible for the material contained within the vial of "GCG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.