Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ZEB1 on HeLa cell. [antibody concentration 10ug/ml])

Mouse anti-Human ZEB1 Monoclonal Antibody | anti-ZEB1 antibody

ZEB1 (AREB6, TCF8, Zinc Finger E-box-binding Homeobox 1, NIL-2-A Zinc Finger Protein, Negative Regulator of IL2, Transcription Factor 8, TCF-8, MGC133261) (Biotin)

Gene Names
ZEB1; BZP; TCF8; AREB6; FECD6; NIL2A; PPCD3; ZFHEP; ZFHX1A; DELTAEF1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZEB1; Monoclonal Antibody; ZEB1 (AREB6; TCF8; Zinc Finger E-box-binding Homeobox 1; NIL-2-A Zinc Finger Protein; Negative Regulator of IL2; Transcription Factor 8; TCF-8; MGC133261) (Biotin); anti-ZEB1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C4
Specificity
Recognizes human ZEB1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ZEB1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa801-901 from ZEB1 (NP_110378) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ZEB1 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ZEB1 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-ZEB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Predicted: 124 kDa

Observed: 130 kDa
NCBI Official Synonym Full Names
zinc finger E-box binding homeobox 1
NCBI Official Symbol
ZEB1
NCBI Official Synonym Symbols
BZP; TCF8; AREB6; FECD6; NIL2A; PPCD3; ZFHEP; ZFHX1A; DELTAEF1
NCBI Protein Information
zinc finger E-box-binding homeobox 1
UniProt Protein Name
Zinc finger E-box-binding homeobox 1
UniProt Gene Name
ZEB1
UniProt Synonym Gene Names
AREB6; TCF8; TCF-8
UniProt Entry Name
ZEB1_HUMAN

NCBI Description

This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Mar 2010]

Uniprot Description

TCF8: Acts as a transcriptional repressor. Inhibits interleukin-2 (IL-2) gene expression. Enhances or represses the promoter activity of the ATP1A1 gene depending on the quantity of cDNA and on the cell type. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Positively regulates neuronal differentiation. Represses RCOR1 transcription activation during neurogenesis. Represses transcription by binding to the E box (5'-CANNTG-3'). Promotes tumorigenicity by repressing stemness-inhibiting microRNAs. Interacts (via N-terminus) with SMARCA4/BRG1. Colocalizes with SMARCA4/BRG1 in E-cadherin- negative cells from established lines, and stroma of normal colon as well as in de-differentiated epithelial cells at the invasion front of colorectal carcinomas. Expressed in heart and skeletal muscle, but not in liver, spleen, or pancreas. Belongs to the delta-EF1/ZFH-1 C2H2-type zinc-finger family.

Protein type: C2H2-type zinc finger protein; Transcription, coactivator/corepressor; Motility/polarity/chemotaxis; DNA-binding

Chromosomal Location of Human Ortholog: 10p11.2

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; nucleus

Molecular Function: protein binding; zinc ion binding; transcription coactivator activity; double-stranded DNA binding; chromatin binding; transcription factor activity; transcription factor binding; transcription corepressor activity

Biological Process: response to nutrient levels; transcription, DNA-dependent; regulation of T cell differentiation in the thymus; semicircular canal morphogenesis; negative regulation of epithelial cell differentiation; negative regulation of transcription from RNA polymerase II promoter; pattern specification process; embryonic skeletal morphogenesis; regulation of transcription from RNA polymerase II promoter; regulation of mesenchymal cell proliferation; cell proliferation; negative regulation of cell proliferation; regulation of transforming growth factor beta receptor signaling pathway; cartilage development; forebrain development; regulation of smooth muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; immune response; embryonic camera-type eye morphogenesis; response to activity; negative regulation of transcription, DNA-dependent; positive regulation of neuron differentiation

Disease: Corneal Dystrophy, Posterior Polymorphous, 3; Corneal Dystrophy, Fuchs Endothelial, 6

Research Articles on ZEB1

Similar Products

Product Notes

The ZEB1 zeb1 (Catalog #AAA6145215) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZEB1 (AREB6, TCF8, Zinc Finger E-box-binding Homeobox 1, NIL-2-A Zinc Finger Protein, Negative Regulator of IL2, Transcription Factor 8, TCF-8, MGC133261) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZEB1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZEB1 zeb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZEB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.