Rabbit anti-Human, Rat GCG Polyclonal Antibody | anti-GCG antibody

GCG Polyclonal Antibody

Cat. Num. AAA9134610

• Gene Names: GCG; GLP1; GLP2; GRPP; GLP-1
• Reactivity: Human, Rat
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: GCG; Polyclonal Antibody; GCG Polyclonal Antibody; GLP-1; GLP1; GLP2; GRPP; anti-GCG antibody

• Host: Rabbit
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Sequence: RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
• Sequence Length: 180

• Applicable Applications for anti-GCG antibody: Western Blot (WB)
• Application Notes: WB: 1:500 - 1:2000
• Immunogen: Recombinant protein of human GCG
• Immunogen Species: Human
• Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Cellular Location: Secreted
• Positive Samples: BXPC-3, 293T, Rat spleen
• Preparation and Storage: Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using GCG antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Related Product Information for anti-GCG antibody

The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.

Product Categories/Family for anti-GCG antibody

Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 4503945
• NCBI GeneID: 2641
• NCBI Accession #: NP_002045.1
• NCBI GenBank Nucleotide #: NM_002054.4
• UniProt Accession #: P01275; Q53TP6; A6NN65
• Molecular Weight: Calculated: 20kDa; Observed: 21kDa
• NCBI Official Full Name: glucagon preproprotein
• NCBI Official Synonym Full Names: glucagon
• NCBI Official Symbol: GCG
• NCBI Official Synonym Symbols: GLP1; GLP2; GRPP; GLP-1
• NCBI Protein Information: glucagon
• UniProt Protein Name: Glucagon
• Protein Family: Glucagon
• UniProt Gene Name: GCG
• UniProt Synonym Gene Names: GRPP; OXM; OXY; GLP-1; GLP-1(7-37); GLP-1(7-36); GLP-2

NCBI Description

The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq, Jul 2008]

Uniprot Description

Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.