Western Blot (WB)
(Recommended G3BP Antibody Titration: 2.5ug/ml)
Rabbit G3BP Polyclonal Antibody | anti-G3BP antibody
G3BP antibody
Reactivity
Human, Mouse, Dog
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
G3BP; Polyclonal Antibody; G3BP antibody; Polyclonal G3BP; Anti-G3BP; GAP SH3 domain binding protein 1; Ras GTPase activating protein SH3 domain binding protein; GBP-3; RasGAP associated endoribonuclease G3BP; GAP binding protein; Ras GTPase activating protein binding protein 1; ATP dependent DNA helicase VIII; GC111040; HDH VIII; G3BP1; GBP 3; anti-G3BP antibody
Host
Rabbit
Reactivity
Human, Mouse, Dog
Clonality
Polyclonal
Specificity
G3BP antibody was raised against the N terminal Of G3Bp
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of G3BP antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
466
Applicable Applications for anti-G3BP antibody
Western Blot (WB)
Application Notes
WB: 2.5 ug/ml
Biological Significance
G3BP is one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Cross-Reactivity
Human,Mouse,Dog
Immunogen
G3BP antibody was raised using the N terminal Of G3Bp corresponding to a region with amino acids EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(Recommended G3BP Antibody Titration: 2.5ug/ml)
Western Blot (WB)
(Recommended G3BP Antibody Titration: 2.5ug/ml)
Western Blot (WB)
(G3BP antibody Western Blot & Peptide Block Validation)
Western Blot (WB)
(G3BP antibody Western Blot & Peptide Block Validation)
Related Product Information for anti-G3BP antibody
Rabbit polyclonal G3BP antibody raised against the N terminal Of G3Bp
Product Categories/Family for anti-G3BP antibody
NCBI and Uniprot Product Information
Similar Products
Product Notes
The G3BP g3bp (Catalog #AAA839069) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The G3BP antibody reacts with Human, Mouse, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's G3BP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 2.5 ug/ml. Researchers should empirically determine the suitability of the G3BP g3bp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "G3BP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
