Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C9ORF127 antibody (MBS839033) used at 2.5 ug/ml to detect target protein.)

Rabbit C9ORF127 Polyclonal Antibody | anti-C9ORF127 antibody

C9ORF127 antibody

Gene Names
TMEM8B; NGX6; NAG-5; C9orf127
Reactivity
Human, Mouse, Rat, Dog
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
C9ORF127; Polyclonal Antibody; C9ORF127 antibody; Polyclonal C9ORF127; Anti-C9ORF127; Chromosome ORF-9; NAG-5; Chromosome ORF 9; NGX6; MGC120460; Chromosome 9 ORF; RP11-112J3.10; anti-C9ORF127 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
C9ORF127 antibody was raised against the C terminal Of C9Orf127
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of C9ORF127 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
787
Applicable Applications for anti-C9ORF127 antibody
Western Blot (WB)
Application Notes
WB: 2.5 ug/ml
Biological Significance
Overexpression of C9orf127 can influence the distribution of the cell cycle in NPC cells and it also plays a role in cell adhesion modulation in NPC cells.
Cross-Reactivity
Human,Mouse,Rat,Dog
Immunogen
C9ORF127 antibody was raised using the C terminal Of C9Orf127 corresponding to a region with amino acids FLLPPRAKTDHGVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICAS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(C9ORF127 antibody (MBS839033) used at 2.5 ug/ml to detect target protein.)

Western Blot (WB) (C9ORF127 antibody (MBS839033) used at 2.5 ug/ml to detect target protein.)
Related Product Information for anti-C9ORF127 antibody
Rabbit polyclonal C9ORF127 antibody raised against the C terminal Of C9Orf127
Product Categories/Family for anti-C9ORF127 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
52 kDa (MW of target protein)
NCBI Official Full Name
chromosome 9 open reading frame 127, isoform CRA_d
NCBI Official Synonym Full Names
transmembrane protein 8B
NCBI Official Symbol
TMEM8B
NCBI Official Synonym Symbols
NGX6; NAG-5; C9orf127
NCBI Protein Information
transmembrane protein 8B
UniProt Protein Name
Transmembrane protein 8B
UniProt Gene Name
TMEM8B
UniProt Synonym Gene Names
C9orf127; NGX6
UniProt Entry Name
TMM8B_HUMAN

Uniprot Description

TMEM8B: May function as a regulator of the EGFR pathway. Probable tumor suppressor which may function in cell growth, proliferation and adhesion. Belongs to the TMEM8 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 9p13.3

Cellular Component: cell surface; mitochondrion; endoplasmic reticulum; integral to membrane; plasma membrane; nucleus

Molecular Function: protein binding

Biological Process: regulation of growth; cell-matrix adhesion; regulation of mitotic cell cycle

Research Articles on C9ORF127

Similar Products

Product Notes

The C9ORF127 tmem8b (Catalog #AAA839033) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C9ORF127 antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's C9ORF127 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 2.5 ug/ml. Researchers should empirically determine the suitability of the C9ORF127 tmem8b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C9ORF127, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.