Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (IARS antibody (MBS838842) used at 1 ug/ml to detect target protein.)

Rabbit IARS Polyclonal Antibody | anti-IARS antibody

IARS antibody

Gene Names
IARS; IRS; ILRS; IARS1; ILERS; PRO0785
Applications
Western Blot
Purity
Affinity purified
Synonyms
IARS; Polyclonal Antibody; IARS antibody; Polyclonal IARS; Anti-IARS; PRO0785; IARS1; ILRS; Isoleucyl-tRNA Synthetase; FLJ20736; anti-IARS antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
IARS antibody was raised against the middle region of IARS
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IARS antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
1055
Applicable Applications for anti-IARS antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Two alternatively spliced variants have been isolated that represent alternate 5' UTRs.
Cross-Reactivity
Human
Immunogen
IARS antibody was raised using the middle region of IARS corresponding to a region with amino acids YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(IARS antibody (MBS838842) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (IARS antibody (MBS838842) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-IARS antibody
Rabbit polyclonal IARS antibody raised against the middle region of IARS
Product Categories/Family for anti-IARS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
144 kDa (MW of target protein)
NCBI Official Full Name
IARS protein
NCBI Official Synonym Full Names
isoleucyl-tRNA synthetase
NCBI Official Symbol
IARS
NCBI Official Synonym Symbols
IRS; ILRS; IARS1; ILERS; PRO0785
NCBI Protein Information
isoleucine--tRNA ligase, cytoplasmic
UniProt Protein Name
Isoleucine--tRNA ligase, cytoplasmic
UniProt Gene Name
IARS
UniProt Synonym Gene Names
IRS; IleRS
UniProt Entry Name
SYIC_HUMAN

NCBI Description

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Alternatively spliced transcript variants have been found. [provided by RefSeq, Nov 2012]

Uniprot Description

IARS: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Two alternatively spliced variants have been isolated that represent alternate 5' UTRs. [provided by RefSeq, Jul 2008]

Protein type: Ligase; EC 6.1.1.5; Amino Acid Metabolism - valine, leucine and isoleucine biosynthesis; Translation

Chromosomal Location of Human Ortholog: 9q21

Cellular Component: nucleoplasm; membrane; cytoplasm; cytosol

Molecular Function: protein binding; ATP binding; isoleucine-tRNA ligase activity

Biological Process: osteoblast differentiation; isoleucyl-tRNA aminoacylation; tRNA aminoacylation for protein translation; regulation of translational fidelity; gene expression

Research Articles on IARS

Similar Products

Product Notes

The IARS iars (Catalog #AAA838842) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's IARS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the IARS iars for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IARS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.