Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CCBL2 antibody (MBS839854) used at 1 ug/ml to detect target protein.)

Rabbit CCBL2 Polyclonal Antibody | anti-CCBL2 antibody

CCBL2 antibody

Gene Names
CCBL2; KAT3; KATIII
Applications
Western Blot
Purity
Affinity purified
Synonyms
CCBL2; Polyclonal Antibody; CCBL2 antibody; Polyclonal CCBL2; Anti-CCBL2; CCBL 2; DKFZp547N1117; RBM1; RBMXL1; KAT3; DKFZp667D0223; RP4-531M19.2; CCBL-2; MGC9398; Cysteine Conjugate-Beta Lyase 2; anti-CCBL2 antibody
Ordering
Host
Rabbit
Clonality
Polyclonal
Specificity
CCBL2 antibody was raised against the C terminal of CCBL2
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCBL2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
290
Applicable Applications for anti-CCBL2 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
CCBL2 is an aminotransferase that transaminates kynurenine to form kynurenic acid. Kynurenic acid is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. One of the transcripts encodes a predicted protein that has sequence identity to the protein encoded by the RNA binding motif protein, X-linked gene (RBMX).
Cross-Reactivity
Human
Immunogen
CCBL2 antibody was raised using the C terminal of CCBL2 corresponding to a region with amino acids LSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(CCBL2 antibody (MBS839854) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (CCBL2 antibody (MBS839854) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-CCBL2 antibody
Rabbit polyclonal CCBL2 antibody raised against the C terminal of CCBL2
Product Categories/Family for anti-CCBL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
48 kDa (MW of target protein)
NCBI Official Full Name
CCBL2 protein
NCBI Official Synonym Full Names
cysteine conjugate-beta lyase 2
NCBI Official Symbol
CCBL2
NCBI Official Synonym Symbols
KAT3; KATIII
NCBI Protein Information
kynurenine--oxoglutarate transaminase 3
UniProt Protein Name
Kynurenine--oxoglutarate transaminase 3
UniProt Gene Name
CCBL2
UniProt Synonym Gene Names
KAT3; KATIII
UniProt Entry Name
KAT3_HUMAN

NCBI Description

This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid. Kynurenic acid is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. This gene shares 5' exon structure with the RNA binding motif protein, X-linked-like 1 locus on chromosome 1, but the coding sequences are non-overlapping. [provided by RefSeq, Jun 2009]

Uniprot Description

CCBL2: Catalyzes the irreversible transamination of the L- tryptophan metabolite L-kynurenine to form kynurenic acid (KA). May catalyze the beta-elimination of S-conjugates and Se- conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond. Has transaminase activity towards L-kynurenine, tryptophan, phenylalanine, serine, cysteine, methionine, histidine, glutamine and asparagine with glyoxylate as an amino group acceptor (in vitro). Has lower activity with 2- oxoglutarate as amino group acceptor (in vitro). Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.6.1.7; EC 2.6.1.63; Transferase; EC 4.4.1.13; Lyase

Chromosomal Location of Human Ortholog: 1p22.2

Cellular Component: mitochondrion

Molecular Function: cysteine-S-conjugate beta-lyase activity; protein homodimerization activity; kynurenine-oxoglutarate transaminase activity; kynurenine-glyoxylate transaminase activity; pyridoxal phosphate binding

Biological Process: amino acid metabolic process; biosynthetic process; tryptophan catabolic process; 2-oxoglutarate metabolic process

Research Articles on CCBL2

Similar Products

Product Notes

The CCBL2 ccbl2 (Catalog #AAA839854) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CCBL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CCBL2 ccbl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCBL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.