Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ATP8B2 antibody (MBS5300284) used at 1 ug/ml to detect target protein.)

Rabbit ATP8B2 Polyclonal Antibody | anti-ATP8B2 antibody

ATP8B2 antibody

Gene Names
ATP8B2; ATPID
Applications
Western Blot
Purity
Affinity purified
Synonyms
ATP8B2; Polyclonal Antibody; ATP8B2 antibody; Polyclonal ATP8B2; Anti-ATP8B2; Atpase Class I Type 8B Member 2; ATPID; KIAA1137; DKFZp434M0219; anti-ATP8B2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
ATP8B2 antibody was raised against the N terminal of ATP8B2
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP8B2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
256
Applicable Applications for anti-ATP8B2 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced transcript variants encoding different isoforms have been identified.
Cross-Reactivity
Human
Immunogen
ATP8B2 antibody was raised using the N terminal of ATP8B2 corresponding to a region with amino acids MAVCAKKRPPEEERRARANDREYNEKFQYASNCIKTSKYNILTFLPVNLF
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(ATP8B2 antibody (MBS5300284) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (ATP8B2 antibody (MBS5300284) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-ATP8B2 antibody
Rabbit polyclonal ATP8B2 antibody raised against the N terminal of ATP8B2
Product Categories/Family for anti-ATP8B2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
44 kDa (MW of target protein)
NCBI Official Full Name
ATP8B2 protein, partial
NCBI Official Synonym Full Names
ATPase, aminophospholipid transporter, class I, type 8B, member 2
NCBI Official Symbol
ATP8B2
NCBI Official Synonym Symbols
ATPID
NCBI Protein Information
phospholipid-transporting ATPase ID
UniProt Protein Name
Phospholipid-transporting ATPase ID
UniProt Gene Name
ATP8B2
UniProt Synonym Gene Names
ATPID; KIAA1137
UniProt Entry Name
AT8B2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

ATP8B2: belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Protein type: EC 3.6.3.1; Transporter; Transporter, ion channel; Membrane protein, integral; Membrane protein, multi-pass; Hydrolase

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: Golgi apparatus; integral to membrane; plasma membrane

Molecular Function: phospholipid-translocating ATPase activity; magnesium ion binding; ATP binding

Biological Process: phospholipid translocation; metabolic process; Golgi organization and biogenesis; transmembrane transport

Research Articles on ATP8B2

Similar Products

Product Notes

The ATP8B2 atp8b2 (Catalog #AAA5300284) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ATP8B2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the ATP8B2 atp8b2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP8B2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.