Rabbit ATP8B2 Polyclonal Antibody | anti-ATP8B2 antibody

ATP8B2 antibody

Cat. Num. AAA5300284

• Gene Names: ATP8B2; ATPID
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: ATP8B2; Polyclonal Antibody; ATP8B2 antibody; Polyclonal ATP8B2; Anti-ATP8B2; Atpase Class I Type 8B Member 2; ATPID; KIAA1137; DKFZp434M0219; anti-ATP8B2 antibody

• Host: Rabbit
• Clonality: Polyclonal
• Specificity: ATP8B2 antibody was raised against the N terminal of ATP8B2
• Purity/Purification: Affinity purified
• Form/Format: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP8B2 antibody in PBS
• Concentration: 1 mg/ml (varies by lot)
• Sequence Length: 256

• Applicable Applications for anti-ATP8B2 antibody: Western Blot (WB)
• Application Notes: WB: 1 ug/ml
• Biological Significance: The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Cross-Reactivity: Human
• Immunogen: ATP8B2 antibody was raised using the N terminal of ATP8B2 corresponding to a region with amino acids MAVCAKKRPPEEERRARANDREYNEKFQYASNCIKTSKYNILTFLPVNLF
• Preparation and Storage: Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(ATP8B2 antibody (MBS5300284) used at 1 ug/ml to detect target protein.)

Related Product Information for anti-ATP8B2 antibody

Rabbit polyclonal ATP8B2 antibody raised against the N terminal of ATP8B2

Product Categories/Family for anti-ATP8B2 antibody

Proteases; Inhibitors; & Enzymes; Purified Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 39794276
• NCBI GeneID: 57198
• Molecular Weight: 44 kDa (MW of target protein)
• NCBI Official Full Name: ATP8B2 protein, partial
• NCBI Official Synonym Full Names: ATPase, aminophospholipid transporter, class I, type 8B, member 2
• NCBI Official Symbol: ATP8B2
• NCBI Official Synonym Symbols: ATPID
• NCBI Protein Information: phospholipid-transporting ATPase ID
• UniProt Protein Name: Phospholipid-transporting ATPase ID
• Protein Family: Phospholipid-transporting ATPase
• UniProt Gene Name: ATP8B2
• UniProt Synonym Gene Names: ATPID; KIAA1137
• UniProt Entry Name: AT8B2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

ATP8B2: belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Protein type: EC 3.6.3.1; Transporter; Transporter, ion channel; Membrane protein, integral; Membrane protein, multi-pass; Hydrolase

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: Golgi apparatus; integral to membrane; plasma membrane

Molecular Function: phospholipid-translocating ATPase activity; magnesium ion binding; ATP binding

Biological Process: phospholipid translocation; metabolic process; Golgi organization and biogenesis; transmembrane transport