Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FOXS1 expression in transfected 293T cell line by FOXS1 polyclonal antibody. Lane 1: FKHL18 transfected lysate (36.3kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human FOXS1 Polyclonal Antibody | anti-Foxs1 antibody

FOXS1 (Forkhead Box Protein S1, Forkhead-like 18 Protein, Forkhead-related Transcription Factor 10, FREAC-10, FKHL18, FREAC10)

Gene Names
Foxs1; Fkh3; Fkhl18; FREAC10
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FOXS1; Polyclonal Antibody; FOXS1 (Forkhead Box Protein S1; Forkhead-like 18 Protein; Forkhead-related Transcription Factor 10; FREAC-10; FKHL18; FREAC10); Anti -FOXS1 (Forkhead Box Protein S1; anti-Foxs1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FKHL18.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE
Applicable Applications for anti-Foxs1 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human FKHL18, aa1-330 (NP_004109.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FOXS1 expression in transfected 293T cell line by FOXS1 polyclonal antibody. Lane 1: FKHL18 transfected lysate (36.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FOXS1 expression in transfected 293T cell line by FOXS1 polyclonal antibody. Lane 1: FKHL18 transfected lysate (36.3kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to FKHL18 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to FKHL18 on HeLa cell. [antibody concentration 10ug/ml].)
Related Product Information for anti-Foxs1 antibody
Transcriptional repressor that suppresses transcription from the FASLG, FOXO3 and FOXO4 promoters. May have a role in the organization of the testicular vasculature.
Product Categories/Family for anti-Foxs1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,567 Da
NCBI Official Full Name
forkhead box protein S1
NCBI Official Synonym Full Names
forkhead box S1
NCBI Official Symbol
Foxs1
NCBI Official Synonym Symbols
Fkh3; Fkhl18; FREAC10
NCBI Protein Information
forkhead box protein S1; FREAC-10; forkhead-like 18 protein; transcription factor FKH-3; forkhead-related transcription factor 10
UniProt Protein Name
Forkhead box protein S1
Protein Family
UniProt Gene Name
Foxs1
UniProt Synonym Gene Names
Fkh3; Fkhl18; Freac10; FREAC-10
UniProt Entry Name
FOXS1_MOUSE

Uniprot Description

FKHL18: Transcriptional repressor that suppresses transcription from the FASLG, FOXO3 and FOXO4 promoters. May have a role in the organization of the testicular vasculature.

Protein type: DNA-binding

Cellular Component: nucleus

Molecular Function: DNA binding; sequence-specific DNA binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter; blood vessel development; regulation of transcription, DNA-dependent; transcription, DNA-dependent; negative regulation of transcription factor activity; positive regulation of multicellular organism growth; neuromuscular process controlling balance; negative regulation of transcription, DNA-dependent

Research Articles on Foxs1

Similar Products

Product Notes

The Foxs1 foxs1 (Catalog #AAA6000111) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FOXS1 (Forkhead Box Protein S1, Forkhead-like 18 Protein, Forkhead-related Transcription Factor 10, FREAC-10, FKHL18, FREAC10) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOXS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the Foxs1 foxs1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQQQPLPGPG APTTEPTKPP YSYIALIAMA IQSSPGQRAT LSGIYRYIMG RFAFYRHNRP GWQNSIRHNL SLNECFVKVP RDDRKPGKGS YWTLDPDCHD MFEHGSFLRR RRRFTRQTGA EGTRGPAKAR RGPLRATSQD PGVPNATTGR QCSFPPELPD PKGLSFGGLV GAMPASMCPA TTDGRPRPPM EPKEISTPKP ACPGELPVAT SSSSCPAFGF PAGFSEAESF NKAPTPVLSP ESGIGSSYQC RLQALNFCMG ADPGLEHLLA SAAPSPAPPT PPGSLRAPLP LPTDHKEPWV AGGFPVQGGS GYPLGLTPCL YRTPGMFFFE. It is sometimes possible for the material contained within the vial of "FOXS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.