Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of LDHC expression in transfected 293T cell line by LDHC polyclonal antibody. Lane 1: LDHC transfected lysate (36.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human LDHC Polyclonal Antibody | anti-LDHC antibody

LDHC (L-lactate Dehydrogenase C Chain, LDH-C, Cancer/Testis Antigen 32, CT32, LDH Testis Subunit, LDH-X, LDH3, LDHX, MGC111073)

Gene Names
LDHC; CT32; LDH3; LDHX
Reactivity
Human
Applications
Western Blot, Immunoprecipitation
Purity
Serum
Serum
Synonyms
LDHC; Polyclonal Antibody; LDHC (L-lactate Dehydrogenase C Chain; LDH-C; Cancer/Testis Antigen 32; CT32; LDH Testis Subunit; LDH-X; LDH3; LDHX; MGC111073); Anti -LDHC (L-lactate Dehydrogenase C Chain; anti-LDHC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LDHC.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF
Applicable Applications for anti-LDHC antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in Western Blot and Immunoprecipitation.
Immunogen
Full length human LDHC, aa1-332 (NP_002292.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LDHC expression in transfected 293T cell line by LDHC polyclonal antibody. Lane 1: LDHC transfected lysate (36.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LDHC expression in transfected 293T cell line by LDHC polyclonal antibody. Lane 1: LDHC transfected lysate (36.3kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of LDHC transfected lysate using LDHC rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with LDHC mouse polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of LDHC transfected lysate using LDHC rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with LDHC mouse polyclonal antibody.)
Related Product Information for anti-LDHC antibody
Lactate dehydrogenase (LDH) is an ubiquitous enzyme commonly found in wide variety of organisms, including plants and microbes. LDH is involved in the interconversion of the pyruvate and NADH to lactate and NAD+. It is also called Hydroxybutyrate Dehydrogenase (HBD), because it can catalyze the oxidation of hydroxybutyrate. In mammals, three types of LDH subunits (35kD) are encoded by the genes Ldh-A, Ldh-B, and Ldh-C. All LDH subunits can combine to form various terameric isoenzymes (140kD). LDHA and LDHB are expressed in most somatic tissues, while expression of LDHC is confined to the germinal epithelium of the testes.
Product Categories/Family for anti-LDHC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,311 Da
NCBI Official Full Name
L-lactate dehydrogenase C chain
NCBI Official Synonym Full Names
lactate dehydrogenase C
NCBI Official Symbol
LDHC
NCBI Official Synonym Symbols
CT32; LDH3; LDHX
NCBI Protein Information
L-lactate dehydrogenase C chain; LDH-C; LDH-X; LDH testis subunit; cancer/testis antigen 32; lactate dehydrogenase C4; lactate dehydrogenase c variant 1; lactate dehydrogenase c variant 3; lactate dehydrogenase c variant 4
UniProt Protein Name
L-lactate dehydrogenase C chain
Protein Family
UniProt Gene Name
LDHC
UniProt Synonym Gene Names
LDH3; LDHX; LDH-C; CT32
UniProt Entry Name
LDHC_HUMAN

NCBI Description

Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region. [provided by RefSeq, Jul 2008]

Uniprot Description

LDH-C: Possible role in sperm motility. Belongs to the LDH/MDH superfamily. LDH family.

Protein type: Carbohydrate Metabolism - glycolysis and gluconeogenesis; Oxidoreductase; EC 1.1.1.27; Amino Acid Metabolism - cysteine and methionine; Carbohydrate Metabolism - propanoate; Cancer Testis Antigen (CTA); Carbohydrate Metabolism - pyruvate

Chromosomal Location of Human Ortholog: 11p15.1

Cellular Component: cytoplasm; nucleus

Molecular Function: L-lactate dehydrogenase activity

Biological Process: sperm motility; ATP biosynthetic process; cellular carbohydrate metabolic process; lactate biosynthetic process from pyruvate; lactate oxidation

Research Articles on LDHC

Similar Products

Product Notes

The LDHC ldhc (Catalog #AAA6005200) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LDHC (L-lactate Dehydrogenase C Chain, LDH-C, Cancer/Testis Antigen 32, CT32, LDH Testis Subunit, LDH-X, LDH3, LDHX, MGC111073) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LDHC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). Suitable for use in Western Blot and Immunoprecipitation. Researchers should empirically determine the suitability of the LDHC ldhc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSTVKEQLIE KLIEDDENSQ CKITIVGTGA VGMACAISIL LKDLADELAL VDVALDKLKG EMMDLQHGSL FFSTSKITSG KDYSVSANSR IVIVTAGARQ QEGETRLALV QRNVAIMKSI IPAIVHYSPD CKILVVSNPV DILTYIVWKI SGLPVTRVIG SGCNLDSARF RYLIGEKLGV HPTSCHGWII GEHGDSSVPL WSGVNVAGVA LKTLDPKLGT DSDKEHWKNI HKQVIQSAYE IIKLKGYTSW AIGLSVMDLV GSILKNLRRV HPVSTMVKGL YGIKEELFLS IPCVLGRNGV SDVVKINLNS EEEALFKKSA ETLWNIQKDL IF. It is sometimes possible for the material contained within the vial of "LDHC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.