Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FOXI1 expression in transfected 293T cell line by FOXI1 polyclonal antibody. Lane 1: FOXI1 transfected lysate (31.13kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human FOXI1 Polyclonal Antibody | anti-FOXI1 antibody

FOXI1 (Forkhead Box I1, FKHL10, Forkhead-Related Transcription Factor 6, FREAC6, HNF-3 Forkhead Homolog 3, HFH3)

Gene Names
FOXI1; HFH3; FKH10; HFH-3; FKHL10; FREAC6; FREAC-6
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FOXI1; Polyclonal Antibody; FOXI1 (Forkhead Box I1; FKHL10; Forkhead-Related Transcription Factor 6; FREAC6; HNF-3 Forkhead Homolog 3; HFH3); Anti -FOXI1 (Forkhead Box I1; anti-FOXI1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FOXI1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPAYVSGGSPTSHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSGVLYPREGTEV
Applicable Applications for anti-FOXI1 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human FOXI1, aa1-283 (NP_658982.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FOXI1 expression in transfected 293T cell line by FOXI1 polyclonal antibody. Lane 1: FOXI1 transfected lysate (31.13kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FOXI1 expression in transfected 293T cell line by FOXI1 polyclonal antibody. Lane 1: FOXI1 transfected lysate (31.13kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to FOXI1 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to FOXI1 on HeLa cell. [antibody concentration 10ug/ml].)
Related Product Information for anti-FOXI1 antibody
This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it is possible that this gene plays an important role in the development of the cochlea and vestibulum, as well as embryogenesis. Mutations in this gene may be associated with the common cavity phenotype. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-FOXI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,973 Da
NCBI Official Full Name
forkhead box protein I1 isoform b
NCBI Official Synonym Full Names
forkhead box I1
NCBI Official Symbol
FOXI1
NCBI Official Synonym Symbols
HFH3; FKH10; HFH-3; FKHL10; FREAC6; FREAC-6
NCBI Protein Information
forkhead box protein I1; forkhead-like 10; HNF-3/fork-head homolog 3; HNF-3/fork-head homolog-3; forkhead-related activator 6; forkhead-related protein FKHL10; forkhead-related transcription factor 6; hepatocyte nuclear factor 3 forkhead homolog 3
UniProt Protein Name
Forkhead box protein I1
Protein Family
UniProt Gene Name
FOXI1
UniProt Synonym Gene Names
FKHL10; FREAC6; FREAC-6; HFH-3
UniProt Entry Name
FOXI1_HUMAN

NCBI Description

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it is possible that this gene plays an important role in the development of the cochlea and vestibulum, as well as embryogenesis. Mutations in this gene may be associated with the common cavity phenotype. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

FOXI1: Transcriptional activator required for the development of normal hearing, sense of balance and kidney function. Required for the expression of SLC26A4/PDS, JAG1 and COCH in a subset of epithelial cells and the development of the endolymphatic system in the inner ear. Also required for the expression of SLC4A1/AE1, SLC4A9/AE4, ATP6V1B1 and the differentiation of intercalated cells in the epithelium of distal renal tubules. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 5q34

Cellular Component: nucleus

Molecular Function: sequence-specific DNA binding; transcription factor activity; DNA bending activity

Biological Process: embryonic development; inner ear morphogenesis; transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter

Disease: Pendred Syndrome; Deafness, Autosomal Recessive 4, With Enlarged Vestibular Aqueduct

Research Articles on FOXI1

Similar Products

Product Notes

The FOXI1 foxi1 (Catalog #AAA6006654) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FOXI1 (Forkhead Box I1, FKHL10, Forkhead-Related Transcription Factor 6, FREAC6, HNF-3 Forkhead Homolog 3, HFH3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOXI1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the FOXI1 foxi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSSFDLPAPS PPRCSPQFPS IGQEPPEMNL YYENFFHPQG VPSPQRPSFE GGGEYGATPN PYLWFNGPTM TPPPYLPGPN ASPFLPQAYG VQRPLLPSVS GLGGSDLGWL PIPSQEELMK LVRPPYSYSA LIAMAIHGAP DKRLTLSQIY QYVADNFPFY NKSKAGWQNS IRHNLSLNDC FKKVPRDEDD PAYVSGGSPT SHPLVTPGLS PEPSDKTGQN SLTFNSFSPL TNLSNHSGGG DWANPMPTNM LSYGGSVLSQ FSPHFYNSVN TSGVLYPREG TEV. It is sometimes possible for the material contained within the vial of "FOXI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.