Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Fkhl18 Antibody Titration: 0.2-1 ug/mlPositive Control: Mouse Brain)

Rabbit Fkhl18 Polyclonal Antibody | anti-FOXS1 antibody

Fkhl18 antibody - C-terminal region

Gene Names
Foxs1; Fkh3; Fkhl18; FREAC10
Reactivity
Cow, Guinea Pig, Horse, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Fkhl18; Polyclonal Antibody; Fkhl18 antibody - C-terminal region; anti-FOXS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MQTLNFCMGTDPGLEHLLVSSVPTPGSSTPSASHRAPLPLPADSKEPWVA
Sequence Length
329
Applicable Applications for anti-FOXS1 antibody
Western Blot (WB)
Homology
Cow: 86%; Guinea Pig: 79%; Horse: 86%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the c terminal region of mouse Fkhl18
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Fkhl18 Antibody Titration: 0.2-1 ug/mlPositive Control: Mouse Brain)

Western Blot (WB) (WB Suggested Anti-Fkhl18 Antibody Titration: 0.2-1 ug/mlPositive Control: Mouse Brain)
Related Product Information for anti-FOXS1 antibody
This is a rabbit polyclonal antibody against Fkhl18. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Fkhl18 is a transcriptional repressor that suppresses transcription from the FASLG, FOXO3 and FOXO4 promoters.Fkhl18 may have a role in the organization of the testicular vasculature.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35
NCBI Official Full Name
forkhead box protein S1
NCBI Official Synonym Full Names
forkhead box S1
NCBI Official Symbol
Foxs1
NCBI Official Synonym Symbols
Fkh3; Fkhl18; FREAC10
NCBI Protein Information
forkhead box protein S1
UniProt Protein Name
Forkhead box protein S1
Protein Family
UniProt Gene Name
Foxs1
UniProt Synonym Gene Names
Fkh3; Fkhl18; Freac10; FREAC-10
UniProt Entry Name
FOXS1_MOUSE

Uniprot Description

FKHL18: Transcriptional repressor that suppresses transcription from the FASLG, FOXO3 and FOXO4 promoters. May have a role in the organization of the testicular vasculature.

Protein type: DNA-binding

Cellular Component: nucleus

Molecular Function: DNA binding; sequence-specific DNA binding; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription from RNA polymerase II promoter; blood vessel development; transcription, DNA-dependent; regulation of transcription, DNA-dependent; negative regulation of transcription factor activity; positive regulation of multicellular organism growth; negative regulation of transcription, DNA-dependent; neuromuscular process controlling balance

Research Articles on FOXS1

Similar Products

Product Notes

The FOXS1 foxs1 (Catalog #AAA3203431) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Fkhl18 antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Fkhl18 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FOXS1 foxs1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MQTLNFCMGT DPGLEHLLVS SVPTPGSSTP SASHRAPLPL PADSKEPWVA. It is sometimes possible for the material contained within the vial of "Fkhl18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.