Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DCP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Rabbit DCP2 Polyclonal Antibody | anti-DCP2 antibody

DCP2 antibody - middle region

Gene Names
DCP2; NUDT20
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DCP2; Polyclonal Antibody; DCP2 antibody - middle region; anti-DCP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KQYQDSPNQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLP
Sequence Length
420
Applicable Applications for anti-DCP2 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DCP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DCP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-DCP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Related Product Information for anti-DCP2 antibody
This is a rabbit polyclonal antibody against DCP2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DCP2 is a key component of an mRNA-decapping complex required for removal of the 5-prime cap from mRNA prior to its degradation from the 5-prime end.DCP2 is a key component of an mRNA-decapping complex required for removal of the 5-prime cap from mRNA prior to its degradation from the 5-prime end (Fenger-Gron et al., 2005 [PubMed 16364915]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-539 AY135173.1 1-539 540-1992 AK090564.1 481-1933 1993-8947 AC008536.7 154323-161277
Product Categories/Family for anti-DCP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
m7GpppN-mRNA hydrolase isoform 1
NCBI Official Synonym Full Names
decapping mRNA 2
NCBI Official Symbol
DCP2
NCBI Official Synonym Symbols
NUDT20
NCBI Protein Information
m7GpppN-mRNA hydrolase
UniProt Protein Name
m7GpppN-mRNA hydrolase
Protein Family
UniProt Gene Name
DCP2
UniProt Synonym Gene Names
NUDT20; Nudix motif 20; hDpc
UniProt Entry Name
DCP2_HUMAN

NCBI Description

The protein encoded by this gene is a key component of an mRNA-decapping complex required for degradation of mRNAs, both in normal mRNA turnover, and in nonsense-mediated mRNA decay (NMD). It removes the 7-methyl guanine cap structure from mRNA, prior to its degradation from the 5' end. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Jun 2011]

Uniprot Description

DCP2: Necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Plays a role in replication-dependent histone mRNA degradation. Removes the 7- methyl guanine cap structure from mRNA molecules, yielding a 5'- phosphorylated mRNA fragment and 7m-GDP. Has higher activity towards mRNAs that lack a poly(A) tail. Has no activity towards a cap structure lacking a RNA moiety. Belongs to the Nudix hydrolase family. DCP2 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; RNA processing; EC 3.6.1.62

Chromosomal Location of Human Ortholog: 5q22.2

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; cell junction; cytosol

Molecular Function: protein binding; m7G(5')pppN diphosphatase activity; exoribonuclease activity, producing 5'-phosphomonoesters; RNA binding; manganese ion binding

Biological Process: mRNA catabolic process; mRNA catabolic process, nonsense-mediated decay; gene expression; mRNA catabolic process, deadenylation-dependent decay

Research Articles on DCP2

Similar Products

Product Notes

The DCP2 dcp2 (Catalog #AAA3205676) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DCP2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DCP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DCP2 dcp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KQYQDSPNQK KRTNGLQPAK QQNSLMKCEK KLHPRKLQDN FETDAVYDLP. It is sometimes possible for the material contained within the vial of "DCP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.