Western Blot (WB)
(WB Suggested Anti-TGM7 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Rabbit TGM7 Polyclonal Antibody | anti-TGM7 antibody
TGM7 antibody - C-terminal region
Gene Names
TGM7; TGMZ
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TGM7; Polyclonal Antibody; TGM7 antibody - C-terminal region; anti-TGM7 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVE
Sequence Length
710
Applicable Applications for anti-TGM7 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 85%; Pig: 93%; Rabbit: 93%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TGM7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TGM7 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Western Blot (WB)
(WB Suggested Anti-TGM7 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Related Product Information for anti-TGM7 antibody
This is a rabbit polyclonal antibody against TGM7. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Transglutaminases (TGM; EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilon¡¡lysine crosslinks. Transglutaminases (TGM; EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilon lysine crosslinks. For additional background information on transglutaminases, see TGM1 (MIM 190195).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2110 AF363393.1 1-2110 2111-2312 BX112796.1 167-368
Target Description: Transglutaminases (TGM; EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilon¡¡lysine crosslinks. Transglutaminases (TGM; EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilon lysine crosslinks. For additional background information on transglutaminases, see TGM1 (MIM 190195).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2110 AF363393.1 1-2110 2111-2312 BX112796.1 167-368
Product Categories/Family for anti-TGM7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80kDa
NCBI Official Full Name
protein-glutamine gamma-glutamyltransferase Z
NCBI Official Synonym Full Names
transglutaminase 7
NCBI Official Symbol
TGM7
NCBI Official Synonym Symbols
TGMZ
NCBI Protein Information
protein-glutamine gamma-glutamyltransferase Z
UniProt Protein Name
Protein-glutamine gamma-glutamyltransferase Z
Protein Family
UniProt Gene Name
TGM7
UniProt Synonym Gene Names
TG(Z); TGZ; TGase Z; TGase-7
UniProt Entry Name
TGM7_HUMAN
NCBI Description
Transglutaminases (TGM; EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilon lysine crosslinks. For additional background information on transglutaminases, see TGM1 (MIM 190195).[supplied by OMIM, Jul 2002]
Uniprot Description
TGM7: an enzyme of the transglutaminase family that catalyzes the crosslinking of proteins and the conjugation of polyamines to proteins. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites and their activity is calcium-dependent.
Protein type: Transferase; EC 2.3.2.13
Chromosomal Location of Human Ortholog: 15q15.2
Molecular Function: protein-glutamine gamma-glutamyltransferase activity; metal ion binding
Biological Process: peptide cross-linking
Research Articles on TGM7
Similar Products
Product Notes
The TGM7 tgm7 (Catalog #AAA3209273) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TGM7 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TGM7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TGM7 tgm7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TQKPFWRHTV RMNLDFGKET QWPLLLPYSN YRNKLTDEKL IRVSGIAEVE. It is sometimes possible for the material contained within the vial of "TGM7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
