Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FFAR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Liver)

Rabbit FFAR1 Polyclonal Antibody | anti-FFAR1 antibody

FFAR1 antibody - N-terminal region

Gene Names
FFAR1; FFA1R; GPR40; GPCR40
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FFAR1; Polyclonal Antibody; FFAR1 antibody - N-terminal region; anti-FFAR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLV
Sequence Length
300
Applicable Applications for anti-FFAR1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 85%; Pig: 92%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FFAR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FFAR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-FFAR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Liver)
Related Product Information for anti-FFAR1 antibody
This is a rabbit polyclonal antibody against FFAR1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FFAR1 is receptor for medium and long chain saturated and unsaturated fatty acids. It binding of the ligand increase intracellular calcium concentration and amplify glucose-stimulated insulin secretion. The activity of this receptor is mediated by G-proteins that activate phospholipase C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
free fatty acid receptor 1
NCBI Official Synonym Full Names
free fatty acid receptor 1
NCBI Official Symbol
FFAR1
NCBI Official Synonym Symbols
FFA1R; GPR40; GPCR40
NCBI Protein Information
free fatty acid receptor 1
UniProt Protein Name
Free fatty acid receptor 1
Protein Family
UniProt Gene Name
FFAR1
UniProt Synonym Gene Names
GPR40
UniProt Entry Name
FFAR1_HUMAN

NCBI Description

This gene encodes a member of the GP40 family of G protein-coupled receptors that are clustered together on chromosome 19. The encoded protein is a receptor for medium and long chain free fatty acids and may be involved in the metabolic regulation of insulin secretion. Polymorphisms in this gene may be associated with type 2 diabetes. [provided by RefSeq, Apr 2009]

Uniprot Description

FFAR1: Receptor for medium and long chain saturated and unsaturated fatty acids. Binding of the ligand increase intracellular calcium concentration and amplify glucose-stimulated insulin secretion. The activity of this receptor is mediated by G- proteins that activate phospholipase C. Seems to act through a G(q) and G(i)-mediated pathway. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR; GPCR, family 1

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; guanyl-nucleotide exchange factor activity; lipid binding; bioactive lipid receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; insulin secretion; energy reserve metabolic process; glucose homeostasis; positive regulation of calcium ion transport; regulation of insulin secretion; positive regulation of GTPase activity

Research Articles on FFAR1

Similar Products

Product Notes

The FFAR1 ffar1 (Catalog #AAA3224424) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FFAR1 antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FFAR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FFAR1 ffar1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KVSEAALSLL VLILIITSAS RSQPKVPEWV NTPSTCCLKY YEKVLPRRLV. It is sometimes possible for the material contained within the vial of "FFAR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.