Western Blot (WB)
(Host: RabbitTarget Name: FAM32ASample Tissue: Human HCT15 Whole CellAntibody Dilution: 1ug/ml)
Rabbit FAM32A Polyclonal Antibody | anti-FAM32A antibody
FAM32A Antibody - N-terminal region
Gene Names
FAM32A; OTAG12; OTAG-12
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FAM32A; Polyclonal Antibody; FAM32A Antibody - N-terminal region; anti-FAM32A antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKAS
Sequence Length
112
Applicable Applications for anti-FAM32A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM32A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: FAM32ASample Tissue: Human HCT15 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: FAM32ASample Tissue: Human HCT15 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-FAM32A antibody
This is a rabbit polyclonal antibody against FAM32A. It was validated on Western Blot
Target Description: Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. FAM32A may also increase cell sensitivity to apoptotic stimuli.
Target Description: Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. FAM32A may also increase cell sensitivity to apoptotic stimuli.
Product Categories/Family for anti-FAM32A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
protein FAM32A
NCBI Official Synonym Full Names
family with sequence similarity 32 member A
NCBI Official Symbol
FAM32A
NCBI Official Synonym Symbols
OTAG12; OTAG-12
NCBI Protein Information
protein FAM32A
UniProt Protein Name
Protein FAM32A
Protein Family
UniProt Gene Name
FAM32A
UniProt Synonym Gene Names
OTAG12; OTAG-12
Uniprot Description
Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. May also increase cell sensitivity to apoptotic stimuli.
Research Articles on FAM32A
Similar Products
Product Notes
The FAM32A fam32a (Catalog #AAA3218428) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM32A Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FAM32A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FAM32A fam32a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DKAKLLEAMG TSKKNEEEKR RGLDKRTPAQ AAFEKMQEKR QMERILKKAS. It is sometimes possible for the material contained within the vial of "FAM32A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
