Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TOB2Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit TOB2 Polyclonal Antibody | anti-TOB2 antibody

TOB2 Antibody - C-terminal region

Gene Names
TOB2; TOB4; TOBL; APRO5; TROB2
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TOB2; Polyclonal Antibody; TOB2 Antibody - C-terminal region; anti-TOB2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSMHSLNFITANPAPQSQLSPNAKEFVYNGGGSPSLFFDAADGQGSGTPG
Sequence Length
344
Applicable Applications for anti-TOB2 antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TOB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TOB2Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TOB2Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TOB2 antibody
This is a rabbit polyclonal antibody against TOB2. It was validated on Western Blot

Target Description: TOB2 belongs to the TOB (see TOB1; MIM 605523)/BTG1 (MIM 109580) family of antiproliferative proteins, which are involved in the regulation of cell cycle progression.
Product Categories/Family for anti-TOB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
protein Tob2 isoform X1
NCBI Official Synonym Full Names
transducer of ERBB2, 2
NCBI Official Symbol
TOB2
NCBI Official Synonym Symbols
TOB4; TOBL; APRO5; TROB2
NCBI Protein Information
protein Tob2
UniProt Protein Name
Protein Tob2
Protein Family
UniProt Gene Name
TOB2
UniProt Synonym Gene Names
KIAA1663; TOB4; TROB2

NCBI Description

TOB2 belongs to the TOB (see TOB1; MIM 605523)/BTG1 (MIM 109580) family of antiproliferative proteins, which are involved in the regulation of cell cycle progression.[supplied by OMIM, Apr 2004]

Uniprot Description

TOB2: Anti-proliferative protein inhibits cell cycle progression from the G0/G1 to S phases. Belongs to the BTG family.

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: protein binding; transcription corepressor activity; vitamin D receptor binding

Biological Process: female gamete generation; negative regulation of cell proliferation; negative regulation of osteoclast differentiation; positive regulation of ossification; regulation of gene expression

Research Articles on TOB2

Similar Products

Product Notes

The TOB2 tob2 (Catalog #AAA3210751) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TOB2 Antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's TOB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TOB2 tob2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSMHSLNFIT ANPAPQSQLS PNAKEFVYNG GGSPSLFFDA ADGQGSGTPG. It is sometimes possible for the material contained within the vial of "TOB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.