Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TMPRSS11ASample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

Rabbit TMPRSS11A Polyclonal Antibody | anti-TMPRSS11A antibody

TMPRSS11A Antibody - C-terminal region

Gene Names
TMPRSS11A; ECRG1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMPRSS11A; Polyclonal Antibody; TMPRSS11A Antibody - C-terminal region; anti-TMPRSS11A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YDACRGDSGGPLVTRDLKDTWYLIGIVSWGDNCGQKDKPGVYTQVTYYRN
Sequence Length
418
Applicable Applications for anti-TMPRSS11A antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 86%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMPRSS11A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TMPRSS11ASample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TMPRSS11ASample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-TMPRSS11A antibody
This is a rabbit polyclonal antibody against TMPRSS11A. It was validated on Western Blot

Target Description: TMPRSS11A is a probable serine protease which may play a role in cellular senescence. Overexpression inhibits cell growth and induce G1 cell cycle arrest.
Product Categories/Family for anti-TMPRSS11A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
transmembrane protease serine 11A isoform 1
NCBI Official Synonym Full Names
transmembrane serine protease 11A
NCBI Official Symbol
TMPRSS11A
NCBI Official Synonym Symbols
ECRG1
NCBI Protein Information
transmembrane protease serine 11A
UniProt Protein Name
Transmembrane protease serine 11A
UniProt Gene Name
TMPRSS11A
UniProt Synonym Gene Names
ECRG1; HATL1; HESP
UniProt Entry Name
TM11A_HUMAN

Uniprot Description

TMPRSS11A: Probable serine protease which may play a role in cellular senescence. Overexpression inhibits cell growth and induce G1 cell cycle arrest. Belongs to the peptidase S1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.21.-; Protease; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q13.2

Cellular Component: integral to plasma membrane; extracellular region

Molecular Function: serine-type endopeptidase activity

Biological Process: cell cycle; proteolysis

Research Articles on TMPRSS11A

Similar Products

Product Notes

The TMPRSS11A tmprss11a (Catalog #AAA3218990) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMPRSS11A Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TMPRSS11A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMPRSS11A tmprss11a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YDACRGDSGG PLVTRDLKDT WYLIGIVSWG DNCGQKDKPG VYTQVTYYRN. It is sometimes possible for the material contained within the vial of "TMPRSS11A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.