Western Blot (WB)
(Western Blot analysis of LOC134145 expression in transfected 293T cell line by LOC134145 polyclonal antibody. Lane 1: LOC134145 transfected lysate (25.63kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human FAM173B Polyclonal Antibody | anti-f173b antibody
FAM173B (LOC134145, Protein FAM173B, FLJ20667)
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
FAM173B; Polyclonal Antibody; FAM173B (LOC134145; Protein FAM173B; FLJ20667); Anti -FAM173B (LOC134145; anti-f173b antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LOC134145.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MEGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAVYAVATPFVTPALRKVCLPFVPATMKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGYELNPWLVWYSRYRAWREGVHGSAKFYISDLWKVTFSQYSNVVIFGVPQMMLQLEKKLERELEDDARVIACRFPFPHWTPDHVTGEGIDTVWAYDASTFRGREKRPCTSMHFQLPIQA
Applicable Applications for anti-f173b antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human LOC134145, aa1-233 (NP_954584).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of LOC134145 expression in transfected 293T cell line by LOC134145 polyclonal antibody. Lane 1: LOC134145 transfected lysate (25.63kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of LOC134145 expression in transfected 293T cell line by LOC134145 polyclonal antibody. Lane 1: LOC134145 transfected lysate (25.63kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-f173b antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
fam173b
NCBI Official Symbol
f173b
NCBI Protein Information
fam173b
Similar Products
Product Notes
The f173b (Catalog #AAA646073) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FAM173B (LOC134145, Protein FAM173B, FLJ20667) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FAM173B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the f173b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEGGGGIPLE TLKEESQSRH VLPASFEVNS LQKSNWGFLL TGLVGGTLVA VYAVATPFVT PALRKVCLPF VPATMKQIEN VVKMLRCRRG SLVDIGSGDG RIVIAAAKKG FTAVGYELNP WLVWYSRYRA WREGVHGSAK FYISDLWKVT FSQYSNVVIF GVPQMMLQLE KKLERELEDD ARVIACRFPF PHWTPDHVTG EGIDTVWAYD ASTFRGREKR PCTSMHFQLP IQA. It is sometimes possible for the material contained within the vial of "FAM173B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
